[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54354.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  189/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:71 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->66 3b7hA PDBj 1e-08 15.2 %
:RPS:SCOP  10->66 2ofyA1  a.35.1.3 * 8e-11 22.8 %
:HMM:SCOP  1->65 2a6cA1 a.35.1.13 * 5.6e-10 23.1 %
:HMM:PFM   20->61 PF01381 * HTH_3 8.5e-09 31.7 41/55  
:BLT:SWISS 1->65 YOZG_BACSU 2e-24 75.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54354.1 GT:GENE BAF54354.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1506618..1506833) GB:FROM 1506618 GB:TO 1506833 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54354.1 LENGTH 71 SQ:AASEQ MAIIVDIDVMLARRKMGVGELAEKIGITPANLSVLKNGRAKAIRFSTLEAICRELGCQPGDILRYDVSLHN GT:EXON 1|1-71:0| BL:SWS:NREP 1 BL:SWS:REP 1->65|YOZG_BACSU|2e-24|75.4|65/84| RP:PDB:NREP 1 RP:PDB:REP 1->66|3b7hA|1e-08|15.2|66/76| HM:PFM:NREP 1 HM:PFM:REP 20->61|PF01381|8.5e-09|31.7|41/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 10->66|2ofyA1|8e-11|22.8|57/82|a.35.1.3| HM:SCP:REP 1->65|2a6cA1|5.6e-10|23.1|65/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 229 OP:NHOMOORG 190 OP:PATTERN ---------------------------------------------1---------------------- -1--2--1111---------------------------------11---21--21------1--1-111------111--21------1111-------1-1-1-2-----------------------------------------------------------------------------1--------1-1111121121212211-11-111211121-1111111-1---------------------11------1-11----1-----------1---1--------------------------211--1111--2111212222212111341---1--1---1--221---------1-------2221-------------1-111-------------1----------------------1121211-----1------------------------------------------------11-----------111---------111-111--1-------------1----------------------------1-------11-------1----------------------------------------11----1------1--21-1------1-12---------------11----------------------------------1--111-----------------1------------------------1-1---1112--------------------------------221211-----------11111111111111-------1--11-----------------------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 94.4 SQ:SECSTR HHHHHHHHHHHHHTTccHHHHHHHHTccHHHHHHHHcTTcccccHHHHHHHHHHHTccHHHHTccTH#### DISOP:02AL 71-72| PSIPRED ccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHEEcHHHcc //