Corynebacterium glutamicum R (cglu2)
Gene : BAF54358.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54358.1 GT:GENE BAF54358.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1508610..1508954 GB:FROM 1508610 GB:TO 1508954 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54358.1 LENGTH 114 SQ:AASEQ MDASNDAPKSINSGANIPRIPVKLSDCVTFVLSPAGSSTNEWLPSISPGNATCPSQRSSRAGSATRMVGVKLIDEPPFSFVNATVFPTTASPLKDVMVGCYSGKDSRSLNTSHT GT:EXON 1|1-114:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11,51-65,107-115| PSIPRED cccccccccccccccccccccEEEccEEEEEEccccccccccccccccccccccccccccccccEEEEEEEEEcccccHHEEEEEcccccccHHHHHHHEEccccccccccccc //