[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54363.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54363.1 GT:GENE BAF54363.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1513249..1513575 GB:FROM 1513249 GB:TO 1513575 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54363.1 LENGTH 108 SQ:AASEQ MTLMWATRGKDWGFRFLDDGGELDPLLIYKQAFADRELAGEFVLIRAEFTATRMFDPLGRTDHAGRIIPHDFVLRGQFAEGITTLEDVQEIIWPLVEKRYEAIWDRSV GT:EXON 1|1-108:0| OP:NHOMO 6 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------221-------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cEEEEEccccccccEEEccccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHccccccccccccccccHHEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHHcccc //