[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54372.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:159 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   100->144 PF05645 * RNA_pol_Rpc82 0.00082 18.6 43/256  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54372.1 GT:GENE BAF54372.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1522151..1522630) GB:FROM 1522151 GB:TO 1522630 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54372.1 LENGTH 159 SQ:AASEQ MLKFQSRALILTVSMLATLSGSSQESDPIQSPITITTTATTMLTTTVTTSAPNPVPPDAQLGDSVDLEVSRATVCIYGDGYGTTTWLAGTDTSCEFVGAVHQKLVTGVNATTEDIRDFLPMDINVTSPVTGQEYQMSCTNESAKVSACRSNTNASVYFY GT:EXON 1|1-159:0| SEG 34->49|titttattmltttvtt| HM:PFM:NREP 1 HM:PFM:REP 100->144|PF05645|0.00082|18.6|43/256|RNA_pol_Rpc82| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----1-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,22-31| PSIPRED ccccccHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEccccccccccccccccccccEEEEcccccEEEEEccccccEEEEcccccccHHHHHHHHHHccccccccHHHHHHcccEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEc //