[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54376.1
DDBJ      :             hypothetical protein
Swiss-Prot:LEUD_CORGB   RecName: Full=3-isopropylmalate dehydratase small subunit;         EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase;         Short=IPMI;

Homologs  Archaea  16/68 : Bacteria  648/915 : Eukaryota  97/199 : Viruses  0/175   --->[See Alignment]
c.8.2
:197 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->169 2hcuA PDBj 4e-33 43.4 %
:RPS:PDB   1->170 1c96A PDBj 8e-44 16.6 %
:RPS:SCOP  7->192 1v7lA  c.8.2.1 * 1e-35 30.2 %
:HMM:SCOP  1->193 1acoA1 c.8.2.1 * 1.2e-50 40.4 %
:RPS:PFM   3->112 PF00694 * Aconitase_C 8e-12 38.2 %
:HMM:PFM   1->113 PF00694 * Aconitase_C 3.9e-31 41.6 113/131  
:BLT:SWISS 1->197 LEUD_CORGB e-114 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54376.1 GT:GENE BAF54376.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1525590..1526183 GB:FROM 1525590 GB:TO 1526183 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54376.1 LENGTH 197 SQ:AASEQ MEKFTTHTGVGVPLQRSNVDTDQIIPAVYLKRVTRTGFEDGLFSNWRQNDPNFVLNTETYKNGSVLIAGPDFGTGSSREHAVWALMDYGFRAVFSSRFADIFRGNSGKAGLLTGIMEQSDIELLWKLMEQTPGLELTVNLEKQIVTAGDVVISFEVDPYIRWRLMEGLDDAGLTLRKLDEIEDYEAKRPAFKPRTNA GT:EXON 1|1-197:0| SW:ID LEUD_CORGB SW:DE RecName: Full=3-isopropylmalate dehydratase small subunit; EC=4.2.1.33;AltName: Full=Isopropylmalate isomerase;AltName: Full=Alpha-IPM isomerase; Short=IPMI; SW:GN Name=leuD; OrderedLocusNames=cgR_1391; SW:KW Amino-acid biosynthesis; Branched-chain amino acid biosynthesis;Complete proteome; Leucine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->197|LEUD_CORGB|e-114|100.0|197/197| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0009082|"GO:branched chain family amino acid biosynthetic process"|Branched-chain amino acid biosynthesis| GO:SWS GO:0009098|"GO:leucine biosynthetic process"|Leucine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 1->169|2hcuA|4e-33|43.4|166/177| RP:PDB:NREP 1 RP:PDB:REP 1->170|1c96A|8e-44|16.6|169/753| RP:PFM:NREP 1 RP:PFM:REP 3->112|PF00694|8e-12|38.2|110/130|Aconitase_C| HM:PFM:NREP 1 HM:PFM:REP 1->113|PF00694|3.9e-31|41.6|113/131|Aconitase_C| GO:PFM:NREP 1 GO:PFM GO:0008152|"GO:metabolic process"|PF00694|IPR000573| RP:SCP:NREP 1 RP:SCP:REP 7->192|1v7lA|1e-35|30.2|159/162|c.8.2.1| HM:SCP:REP 1->193|1acoA1|1.2e-50|40.4|188/0|c.8.2.1|1/1|LeuD/IlvD-like| OP:NHOMO 847 OP:NHOMOORG 761 OP:PATTERN ------------------------1--111112-1-21--1----1--1----1------------22 1111111111111111111-111111111111111111221111111--111111111--111111111111111111-1--211-1-111111---11--1-1111111------------------111--1--11111---11111111111111111111111111-111111111111111111--11111111111111111111111111111111--11111111-1111111111111111111-------1------------1111-1-------11111111111111-------------111111111--2--1-------1-1--11---------1----------1---------1-112111-----212221111111111111111111-11211311111-1112111111112143122111111121111111111111111-----------------------------111311132221112111111111211111-1214214311221111111111122211111211111111111111--2111---1-----1111111121111-1-2-11-111111---------------111111111-2111111111111111111111-1-1111-11--111111111111111111-11-1111111111111111111111112121212222212112111111111-11111111111111-1---------11111111112-11111111111111111121111111221112111111-1-11-1-111111111111111111111111111111111221111-----------------------------------------------11 --------------11111111111111111111111111-11111--11111111121111111111-11211111-1111111111-11111111111111112--1---------------------------------------------------------------------1911---2---1-111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 96.4 SQ:SECSTR HHHcccGGGGGGTccHHHHGGGcTTTcccTTTcccccEEcTTTccEEcHcHHHHHHHHHHTccEEEEcccccTcccccTHHHHHHHHTTEEEEEEccccHHHHHHHHHTTcEGGGccTTcEEEEEcGGGccTTccEEEEEcEEEEEEEccccHHHHHHHHHTcHHHHHHHHHHHHHHHTcHHHHHHHHHH####### DISOP:02AL 1-1| PSIPRED ccccEEEEEEEEEEEcccccHHHcccHHHcccccHHHHHHHHHHHHccccccccccHHHHccccEEEEEccccccccHHHHHHHHHHcccEEEEEccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHcccccEEEEEccccEEEEccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccccc //