[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54394.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  107/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:326 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->305 PF04018 * DUF368 8e-31 36.6 %
:HMM:PFM   36->277 PF04018 * DUF368 1e-73 38.7 238/258  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54394.1 GT:GENE BAF54394.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1542243..1543223) GB:FROM 1542243 GB:TO 1543223 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54394.1 LENGTH 326 SQ:AASEQ MSATNPDALDVQHVYPIKTKKTPLAVIFNIISGGLIGMAELVPGISGGTVALVLGIYERALHNGDLLIDLIKVLIKDRSKVKEAAAKIDWWFLGAIGVGMVVMVFSMSSILHTVVEDYPEITRGLFLGMVAVSILVPLGMMDMRDAKKRLAIVIPLFIICAMLGFFGTSFTSAPRTDPSLIFVFICAAIAVCALVLPGVSGSFFLLAVGMYAPIMESLSNRDLSVIGVFLLGALTGVILFVKVLSYVLEHHRTITLTIMAGLMLGSLRALWPWQDGDANLLAPGDNAVMIFSIVILGGAIVAALMFAERVSSKNIDSEIVAEEQPR GT:EXON 1|1-326:0| TM:NTM 8 TM:REGION 23->45| TM:REGION 90->112| TM:REGION 121->143| TM:REGION 150->171| TM:REGION 186->208| TM:REGION 225->247| TM:REGION 251->273| TM:REGION 288->310| SEG 65->77|dllidlikvlikd| SEG 100->109|mvvmvfsmss| RP:PFM:NREP 1 RP:PFM:REP 36->305|PF04018|8e-31|36.6|238/241|DUF368| HM:PFM:NREP 1 HM:PFM:REP 36->277|PF04018|1e-73|38.7|238/258|DUF368| OP:NHOMO 117 OP:NHOMOORG 117 OP:PATTERN -------------------------11-111-111--1-------1---------------------- -----1111111-1--------------------------------111---------------------1---------1------------1--1---1--11---1---------------------1---11---11--------------------------------------------------------------------11-----------1-1---------11111111111111-11------1------------------------------1-----------------------------------11---------1------------1------1-------------------1--------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------1------1----------------------------------------------------11--1-111111-1111111111111--1-----------------------------------------------------------------------------------------------------------1-11----------------------111-1--------1----1-------------11111111111111------------------11------------------------------------------1--1-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5,322-327| PSIPRED cccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccc //