[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54398.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54398.1 GT:GENE BAF54398.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1548381..1548995 GB:FROM 1548381 GB:TO 1548995 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54398.1 LENGTH 204 SQ:AASEQ MTIDGKEVSLDLPNKELESLGLDEYSTSPSGASIAVTNEGGGAFRSLIHIPNLESNGEFEFSFSNDMTLSSLPDGGVTVRDNKGDILGTLDAPWAIDATGASVKTWYEIRQSTIVQHVAPTSSTQFPVVADPFWIPFLGIMGGHLTRHALTQMAKRKITKELVEHVIKTGRGSKGNGNTTVFNGNGIRVIVDNVSGNVITVTKG GT:EXON 1|1-204:0| SEG 175->186|gngnttvfngng| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------1-111--------------------------2-------------2---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-3,204-205| PSIPRED cEEcccEEEccccHHHHHHcccEEccccccccEEEEEEEcccEEEEEEEccccccccEEEEEcccccEEEEcccccEEEEEccccEEEEEccccEEcccccccEEEEEEEccEEEEEEEccccccccEEccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccEEEEEEEcccccEEEEEcc //