[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54403.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   95->112 PF04212 * MIT 0.00064 44.4 18/69  
:BLT:SWISS 40->109 DDX17_MOUSE 5e-04 30.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54403.1 GT:GENE BAF54403.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1553235..1553612) GB:FROM 1553235 GB:TO 1553612 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54403.1 LENGTH 125 SQ:AASEQ MKYFALNRDNLIGPAVEILAPLGWASYGLWHRRGTEQIVELARRGTDSAEIDALVTQQWNNTSESFLHHVAIPLRRYGRGIDYSFQRLQFQRGNLIDQAVKCHENGNYAAAILLTFPKSMGLPEI GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 40->109|DDX17_MOUSE|5e-04|30.3|66/650| TM:NTM 1 TM:REGION 9->31| HM:PFM:NREP 1 HM:PFM:REP 95->112|PF04212|0.00064|44.4|18/69|MIT| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,124-126| PSIPRED ccEEEEccccccccHHHHHHcccHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHccccEEEEEEEEcccccccccc //