[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54408.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:94 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->80 PF06728 * PIG-U 0.00073 22.4 76/174  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54408.1 GT:GENE BAF54408.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1556432..1556716) GB:FROM 1556432 GB:TO 1556716 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54408.1 LENGTH 94 SQ:AASEQ MLTGILLAMVSTALRIRFGSGVAIAATVLWTVISITLGGDVLAETMLWLVAVPSWPETADTTTRFLIAMLLQAVLITGSTIWAIREIRDSERRG GT:EXON 1|1-94:0| TM:NTM 2 TM:REGION 26->48| TM:REGION 63->85| HM:PFM:NREP 1 HM:PFM:REP 5->80|PF06728|0.00073|22.4|76/174|PIG-U| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 90-95| PSIPRED cHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcc //