[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54430.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  391/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:200 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->179 1xm8A PDBj 3e-09 28.6 %
:RPS:PDB   48->186 1bc2A PDBj 9e-13 14.6 %
:RPS:SCOP  48->199 1qh3A  d.157.1.2 * 3e-19 21.8 %
:HMM:SCOP  5->196 1qh5A_ d.157.1.2 * 1.5e-39 37.8 %
:RPS:PFM   51->146 PF00753 * Lactamase_B 4e-09 42.6 %
:HMM:PFM   16->179 PF00753 * Lactamase_B 2.8e-22 30.3 152/194  
:BLT:SWISS 48->189 YCBL_ECOLI 2e-15 38.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54430.1 GT:GENE BAF54430.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1588693..1589295) GB:FROM 1588693 GB:TO 1589295 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54430.1 LENGTH 200 SQ:AASEQ MTNELTLHHISVSQMDNNCYLLAANGNGLLIDAADDAAALLKLAEDAGVTITKVLTTHRHADHVRALPEVLQKTGATHYAPFLEVPALPSAVDVELHHGDSIEFEGHVFPISILRGHTPGGAVLTAEIDGKTHLFVGDSLFPGGLGKTSSEGDFVRLFNDVKERIFDTYDDDSIVWPGHGKETTLGAERPQLEIWWERRW GT:EXON 1|1-200:0| BL:SWS:NREP 1 BL:SWS:REP 48->189|YCBL_ECOLI|2e-15|38.4|138/215| SEG 29->47|llidaaddaaallklaeda| BL:PDB:NREP 1 BL:PDB:REP 48->179|1xm8A|3e-09|28.6|126/254| RP:PDB:NREP 1 RP:PDB:REP 48->186|1bc2A|9e-13|14.6|137/216| RP:PFM:NREP 1 RP:PFM:REP 51->146|PF00753|4e-09|42.6|94/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 16->179|PF00753|2.8e-22|30.3|152/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 48->199|1qh3A|3e-19|21.8|147/260|d.157.1.2| HM:SCP:REP 5->196|1qh5A_|1.5e-39|37.8|185/260|d.157.1.2|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 467 OP:NHOMOORG 396 OP:PATTERN -------------------------------------------------------------------- --11222333332322222-2111212222221222213312222-12-11-221221--11212241212-------11111--1--1111-1--1------111-11------------------------------111111-----11-11----------1-111-------------11------11-------------------------2221---1-----111111111111111111111------------------------111---------------------------------------------2111-------1--11111111--1--12-11--11111111111-1--11--11-1-1-1----------1--------------11111121--11-11111211-111211--------------------------1-----------------------------------1111-111111-1111111-1111111111212--1111111111-1-11-111-111----------111-21211-1-------11111111111-12--21----11111--------------------111-----------------1----1-1--11-1------11-111-1111111111-11111111111111111111111111-111111111111111111111111--11111111111111-----------111--111---111111----------11---1--1-----------------------11111111111111----------------11----------------1-----------------------------------11- -------------------------------------------------------------------------------------------------------------222---------------------------------------------------1--------------1-------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 99.0 SQ:SECSTR ##ccEEEEEEEcccccccEEEEEETTcccTTTTccEEEEccHHHHHTTccEEEEEcccccHHHHTTHHHHHHTTcEEEccHHHHHHTTccccccccccEEEEEETTEEEEEEcccccccccccEEEEETTTTEEEEETTcccTTcccccccccHHHHHHHHHHHHHHHccccccEEEcccccccTHHHHHHHHHHHHHTE DISOP:02AL 1-3| PSIPRED ccccEEEEEEEccccccEEEEEEEccEEEEEEccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHcccEEEEcHHHHHHHHccccEEEEcccEEEEccEEEEEEEEcccccccEEEEEEEccccEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccHHHccc //