[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54447.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->70 PF01298 * Lipoprotein_5 5.1e-05 33.3 60/593  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54447.1 GT:GENE BAF54447.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1609466..1609870 GB:FROM 1609466 GB:TO 1609870 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54447.1 LENGTH 134 SQ:AASEQ MAIYRKLAASAAALALSASLVACGDSEDTTEETSTTSSSTTSSSSSSSSSSTAATSEESSAVEEPAVEAPVEEAPVEAPVEQAPVVEQAPVEQAPAPVQEAPAPVEQAPAPVQEAPAADAPPALPGGGGGHAGY GT:EXON 1|1-134:0| TM:NTM 1 TM:REGION 7->25| SEG 7->20|laasaaalalsasl| SEG 26->123|sedtteetsttsssttsssssssssstaatseessaveepaveapveeapveapveqapvveqapveqapapvqeapapveqapapvqeapaadappa| HM:PFM:NREP 1 HM:PFM:REP 10->70|PF01298|5.1e-05|33.3|60/593|Lipoprotein_5| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,20-135| PSIPRED ccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //