[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54465.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  508/915 : Eukaryota  15/199 : Viruses  0/175   --->[See Alignment]
c.66.1d.66.1
:273 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->270 3hp7A PDBj 5e-35 38.2 %
:RPS:PDB   3->70 1c05A PDBj 2e-07 25.0 %
:RPS:PDB   86->209 3cjqG PDBj 5e-09 19.5 %
:RPS:SCOP  5->107 1fjgD  d.66.1.2 * 6e-08 29.5 %
:RPS:SCOP  85->199 2f8lA1  c.66.1.45 * 7e-07 16.5 %
:HMM:SCOP  6->106 1c06A_ d.66.1.2 * 4.2e-17 36.4 %
:HMM:SCOP  61->251 1ej0A_ c.66.1.2 * 7e-25 29.4 %
:RPS:PFM   64->170 PF01728 * FtsJ 6e-09 48.0 %
:HMM:PFM   63->245 PF01728 * FtsJ 1.2e-19 34.9 152/181  
:HMM:PFM   5->49 PF01479 * S4 6.1e-10 37.8 45/48  
:BLT:SWISS 4->246 YQXC_BACSU 1e-38 38.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54465.1 GT:GENE BAF54465.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1631617..1632438 GB:FROM 1631617 GB:TO 1632438 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54465.1 LENGTH 273 SQ:AASEQ MVARRRLDAELVRRKIARSREHAVEMIRGRRVFVAGMLALKPATVVEPEVSIRVEEDASEDWASRGAHKLLGALESFEPLGLKVKGRRVLDAGASTGGFTDVLLRREASEVVAVDVGYGQLIWRLQNDDRVRVVDRTNIRYMTLEDTGGECDMMVGDLSFISLKLTLPAIAKVLSDGADLLPMVKPQFEVGKDRLGSGGVVRSPELRAEVTADVAKFAATLGLSLKHVVASPLPGPSGNVEYFLWLVKDGGASMPDDQQLSAMIDTAVKEGPQ GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 4->246|YQXC_BACSU|1e-38|38.5|239/281| BL:PDB:NREP 1 BL:PDB:REP 4->270|3hp7A|5e-35|38.2|259/270| RP:PDB:NREP 2 RP:PDB:REP 3->70|1c05A|2e-07|25.0|68/159| RP:PDB:REP 86->209|3cjqG|5e-09|19.5|123/252| RP:PFM:NREP 1 RP:PFM:REP 64->170|PF01728|6e-09|48.0|100/179|FtsJ| HM:PFM:NREP 2 HM:PFM:REP 63->245|PF01728|1.2e-19|34.9|152/181|FtsJ| HM:PFM:REP 5->49|PF01479|6.1e-10|37.8|45/48|S4| GO:PFM:NREP 3 GO:PFM GO:0003676|"GO:nucleic acid binding"|PF01728|IPR002877| GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01728|IPR002877| GO:PFM GO:0032259|"GO:methylation"|PF01728|IPR002877| RP:SCP:NREP 2 RP:SCP:REP 5->107|1fjgD|6e-08|29.5|95/208|d.66.1.2| RP:SCP:REP 85->199|2f8lA1|7e-07|16.5|115/323|c.66.1.45| HM:SCP:REP 6->106|1c06A_|4.2e-17|36.4|99/159|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 61->251|1ej0A_|7e-25|29.4|170/0|c.66.1.2|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 533 OP:NHOMOORG 524 OP:PATTERN ------------------------------------------------1------------------- 1111111111111111111-11111111111111111111111111111111111111--1111111111111111111112111111------------------------------------------------11111---111111111111111111111111111111111111111---111111111111111111111111111111111111111111111111-------------------111111111-111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111-11-1-111111111111111111111111111111111-11111111111-11111111111111111----------1111111111111111------------1111111111111-----11111--------------------------------------11111111111-------11-----------11111111111111111111111111111111111111111111111111111111111-------1---------------------------------------------------------------------------------------------------------------------------------------111------------------------------------------------------------------------------------1111111111111111--1----1--111---111111-1-11111-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1117111111111-12------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 269 STR:RPRED 98.5 SQ:SECSTR #THHHcHHHHHHHTTccccHHHHHHHHHTTcEEETTEEcccccccccTTcEEEEcGGGcccTTcHHHHHHHHHHHHHcccccccTTcEEEEEccTTcHHHHHHHHTTccEEEEEEccGGGHHHHHHHHHTTTcccEEEEccHHHHGGGccEEEEEEEccHHHHHHHHHHHHHHEEEEEEEEEEEGGGHHHHHHHHHHTTcEEEEEEEETEHHHHHHHHHHTTEEEEEEEEEEccGGGTTTTTHHHHEEEEcccccHHHHHHHHHHHHHHH### DISOP:02AL 1-3,267-274| PSIPRED cccHHHHHHHHHHccccccHHHHHHHHHcccEEEccEEEcccccccccccEEEEccccccccHHHHHHHHHHHHHHcccccccccccEEEEEcccccHHHHHHHHccccEEEEEEEccccccHHHHccccEEEEccccHHHccHHHccccccEEEEEccHHHHHHHHHHHHHHHccccEEEEEEccHHcccHHHcccccEEccHHHHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHccc //