[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54482.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.80.8
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   43->214 3du1X PDBj 3e-06 28.1 %
:RPS:PDB   39->211 2bm7C PDBj 4e-16 17.3 %
:RPS:SCOP  32->187 2j8kA1  b.80.8.1 * 1e-14 19.9 %
:HMM:SCOP  39->216 2bm5A1 b.80.8.1 * 9.7e-26 21.9 %
:HMM:PFM   125->156 PF00805 * Pentapeptide 3.6e-05 34.4 32/40  
:BLT:SWISS 44->186 YMO3_ERWST 1e-07 24.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54482.1 GT:GENE BAF54482.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1651039..1651707) GB:FROM 1651039 GB:TO 1651707 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54482.1 LENGTH 222 SQ:AASEQ MASPRRPQVAAPRIKELRLTGLDNADPQDIESNEQMESCRFNEAELSERDLSGAGFIECEFLGLEAHETELRRAQFVETRIERANAPSFKAARSIWRNATISDSRFGAVEMYEATVQALKISDSKLSFVNLRGASLRDVLFENCVIDELDLGQARAERIAFKDCTVHSLTFDHAVLSNVDLRGLDIERISGVESMSGTVISSLQAADLSGAFARHLGITVND GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 44->186|YMO3_ERWST|1e-07|24.5|143/295| BL:PDB:NREP 1 BL:PDB:REP 43->214|3du1X|3e-06|28.1|160/237| RP:PDB:NREP 1 RP:PDB:REP 39->211|2bm7C|4e-16|17.3|168/180| HM:PFM:NREP 1 HM:PFM:REP 125->156|PF00805|3.6e-05|34.4|32/40|Pentapeptide| RP:SCP:NREP 1 RP:SCP:REP 32->187|2j8kA1|1e-14|19.9|156/175|b.80.8.1| HM:SCP:REP 39->216|2bm5A1|9.7e-26|21.9|178/0|b.80.8.1|1/1|Pentapeptide repeat-like| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN ---------------------------------------------------1---------------- ----1---111---------------------------------1-1-11--1111----1-----1111--111-----1---------1-----------------------------------------------------1--1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 90.5 SQ:SECSTR ###############HHHHHHHHcccc####TTccEEccEEEccccTTcccTTcEEEccEEEccccTTcccTTcEEEccEEETcEEEccccTTEEEEEEEccccEEEccccEccccccEEEEEEEcTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTccccHHccccHHHHHHHHHTTTccccccccTHTTccc## DISOP:02AL 1-2,222-223| PSIPRED ccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccEEcccccccccccccEEcccEEEcccccccccccccccccEEcccEEEccEEccccccccccccccccccccccccccccEEcccEEcccEEcccccccccccccEEEccEEcccEEcccEEEcccccccEEccccccHHHccccccccccccccccccHHcccEEcc //