[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54483.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.60.1
:166 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->159 2kcuA PDBj 2e-04 20.5 %
:RPS:PDB   10->166 3e0hA PDBj 2e-20 23.3 %
:RPS:SCOP  10->166 1jyhA  d.60.1.3 * 2e-14 18.4 %
:HMM:SCOP  9->166 1jyhA_ d.60.1.3 * 7.5e-15 23.8 %
:RPS:PFM   42->163 PF06445 * AraC_E_bind 3e-08 33.9 %
:HMM:PFM   11->165 PF06445 * AraC_E_bind 1.3e-18 24.0 146/154  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54483.1 GT:GENE BAF54483.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1651782..1652282) GB:FROM 1651782 GB:TO 1652282 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54483.1 LENGTH 166 SQ:AASEQ MYLLNPPVTEPEILTVNEIPTVVAVFDNHPMNDMPAAFDQTYQVLFPTLGAKGIAPIGPGFALYTSEPTDTVSFEVGIPVSQPLEGDVSAANGIVLKNSVVPAGKIARISHIGSFDGLSQAWGSFVEALESAGHEIDMPYWEVYVTEPSPDIDPATLQTDLYVLLK GT:EXON 1|1-166:0| BL:PDB:NREP 1 BL:PDB:REP 31->159|2kcuA|2e-04|20.5|122/166| RP:PDB:NREP 1 RP:PDB:REP 10->166|3e0hA|2e-20|23.3|146/149| RP:PFM:NREP 1 RP:PFM:REP 42->163|PF06445|3e-08|33.9|115/152|AraC_E_bind| HM:PFM:NREP 1 HM:PFM:REP 11->165|PF06445|1.3e-18|24.0|146/154|AraC_E_bind| RP:SCP:NREP 1 RP:SCP:REP 10->166|1jyhA|2e-14|18.4|147/155|d.60.1.3| HM:SCP:REP 9->166|1jyhA_|7.5e-15|23.8|147/155|d.60.1.3|1/1|Probable bacterial effector-binding domain| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- -------2111-----------------------------------1---------1-------1-1--------------------------------------------------------------11----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 100.0 SQ:SECSTR HHHccccTTcEEEEEEcccEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHTTcccccccEEEEEcTTcccEEEEEEEEccccccccTTcEEEEcTcEEEEccEEEEEEEEEccGGGTHHHHHHHHHHHHHTTccEEEEEEEEEcccTcTcccGGGcEEEEEEEcc DISOP:02AL 1-6| PSIPRED ccccccccccccEEEEcccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccEEEEEEEEccccccccccccccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHEEEEHHEEcc //