[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54484.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  104/915 : Eukaryota  36/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:271 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   62->233 2yr0A PDBj 3e-07 32.5 %
:RPS:PDB   40->260 3bxoA PDBj 2e-12 15.2 %
:RPS:SCOP  59->232 2avnA1  c.66.1.41 * 9e-14 24.4 %
:HMM:SCOP  1->210 1p91A_ c.66.1.33 * 3.8e-23 26.9 %
:RPS:PFM   60->151 PF01209 * Ubie_methyltran 4e-05 39.1 %
:HMM:PFM   62->149 PF08241 * Methyltransf_11 1e-15 30.7 88/95  
:BLT:SWISS 26->251 Y3374_MYCBO 5e-35 38.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54484.1 GT:GENE BAF54484.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1652294..1653109) GB:FROM 1652294 GB:TO 1653109 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54484.1 LENGTH 271 SQ:AASEQ MNDPAHPPIPPVSKRDAPAFSDLQHRATSASAFTQGSTTYHDVRPGYPAEAVELARGFGRVLDVGAGTGKLTSELTADQVLALDPSMDMLRVFRSALPAVPCWQATAEHTGIRDNVVDLITCAQTWHWVDVTAASAEFDRVIAPEGAVLLVWNNLDTSIAWVHRLSRIMHAGDVLKPGFTPETAAPWIIDREIRTTWNQHLTPEEIIQLAHTRSYWLNASEKIKERVDQNLRWYLYEHLGFSPDNPVELPYRCDAFLLSRSGTLAGRSSNL GT:EXON 1|1-271:0| BL:SWS:NREP 1 BL:SWS:REP 26->251|Y3374_MYCBO|5e-35|38.1|223/243| BL:PDB:NREP 1 BL:PDB:REP 62->233|2yr0A|3e-07|32.5|163/243| RP:PDB:NREP 1 RP:PDB:REP 40->260|3bxoA|2e-12|15.2|210/236| RP:PFM:NREP 1 RP:PFM:REP 60->151|PF01209|4e-05|39.1|92/234|Ubie_methyltran| HM:PFM:NREP 1 HM:PFM:REP 62->149|PF08241|1e-15|30.7|88/95|Methyltransf_11| GO:PFM:NREP 1 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF01209|IPR004033| RP:SCP:NREP 1 RP:SCP:REP 59->232|2avnA1|9e-14|24.4|164/246|c.66.1.41| HM:SCP:REP 1->210|1p91A_|3.8e-23|26.9|193/268|c.66.1.33|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 155 OP:NHOMOORG 142 OP:PATTERN --------------------------------------------------------------11---- 1---1111111-1-12211-11--111111111111---1-11-111--11--11-11--1-1-1--111----------------------------------1---------------------------------------2----------------------------------------1--------111111-1-1111-1------11----1----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------------1-1-------1-------------------------------------------------------1-------------------------------1111-------------------1---1--------------1------------------1---------1-----------------------1-----1-------------------------------------------------------------------------------------------------------1------------------------------------------------------11111-1-----11211-11---------------------------------111-1--111--------------------------------------------------------------1 ----231-------11--------------------------------11--1-11------111----1--1-----------1-11-111-1-1---11--212-1--2-----------------------------------------------------1--------11---------21------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 95.6 SQ:SECSTR ##HHTTcccccccHHHHHHHHHTcccccHHHHcccTTTcHHHHHHHHHHHHHHHcTTccEEEEETcTTcHHHHHHHHHEEEEEEccHHHHHHHHHHcTTcEEcTTTccccccEEEEEEcTTGGGGcccHHHHHHHHHHHHTEEEEEEEEEcccccTTTccTTcEEEEEEEETTEEEEEEEEEEEETTEEEEEEEEEEEETccTTEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHTTEEEEEEccTTTcccEEEEEEc########## DISOP:02AL 1-4,266-272| PSIPRED cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccEEEEEcccccHHHHHHcccEEEEEEccHHHHHHHHHcccccEEEEccHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHcccccccccccHHHcccccccccccHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEEEEcccccccccccc //