[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54485.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1f.37.1
:482 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->310 3b60A PDBj 5e-06 18.7 %
:BLT:PDB   412->457 3d31A PDBj 2e-05 37.0 %
:RPS:PDB   194->293 2bnlB PDBj 9e-08 8.1 %
:RPS:PDB   413->458 1aroP PDBj 8e-08 4.3 %
:RPS:SCOP  10->309 2hydA2  f.37.1.1 * 1e-27 17.2 %
:RPS:SCOP  412->472 1e69A  c.37.1.12 * 1e-06 18.0 %
:HMM:SCOP  5->422 1pf4A2 f.37.1.1 * 5.1e-53 22.3 %
:HMM:SCOP  392->460 1ewqA2 c.37.1.12 * 1e-09 35.3 %
:RPS:PFM   25->277 PF00664 * ABC_membrane 2e-14 25.0 %
:HMM:PFM   17->278 PF00664 * ABC_membrane 1.9e-26 23.0 257/275  
:HMM:PFM   347->432 PF00005 * ABC_tran 1.1e-10 36.2 80/118  
:BLT:SWISS 27->459 YHEI_BACSU 6e-13 24.2 %
:PROS 404->418|PS00211|ABC_TRANSPORTER_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54485.1 GT:GENE BAF54485.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1653301..1654749 GB:FROM 1653301 GB:TO 1654749 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54485.1 LENGTH 482 SQ:AASEQ MALSQRPWSFVASAGMAASFICNGLTPVIVGKAVDEAIGTSDLQRLWFWIAMLAVLFLTAMTVNWIARYMLVRSQQLVSHDLRMLVTDRIQDPRGFAGKERTAGGLLSIASSDTQRVGDIVMMTVFPVAELASIIYGAVVMYSINPWLSVAVLIGGPLLVVVAIQVSKPLQKRSGARQQAVAQAAATATDVVQGLRILKGLGAIVTVRRRYEAISGEAYRKTVHAEAAEARLNGVTDAAGAIFVSALGIGAGFLALHGQMSIGDLITVVGLTQFLIMPMTMLGRNVASRWASAEASAKRIRGVLGADFERVSAHDADKAEEIIQQLAKGLTVIRGTDEQLVEVLEQLPRTRVIVAPHAADLFDQSVRDNVHPVAEVAEKAIEVASCDDIPGGSSKIVGEGGRLLSGGQRQRVALARAIAFDPEVLVLQDPTTAVDSVTEQNIAQQVAAHRAGKVTIVFSEAPAWSAVADQHVEAAALRAVMK GT:EXON 1|1-482:0| BL:SWS:NREP 1 BL:SWS:REP 27->459|YHEI_BACSU|6e-13|24.2|425/585| PROS 404->418|PS00211|ABC_TRANSPORTER_1|PDOC00185| TM:NTM 6 TM:REGION 7->29| TM:REGION 44->66| TM:REGION 118->140| TM:REGION 147->169| TM:REGION 235->257| TM:REGION 264->286| SEG 176->193|arqqavaqaaatatdvvq| SEG 373->384|vaevaekaieva| SEG 398->411|geggrllsggqrqr| BL:PDB:NREP 2 BL:PDB:REP 34->310|3b60A|5e-06|18.7|267/572| BL:PDB:REP 412->457|3d31A|2e-05|37.0|46/348| RP:PDB:NREP 2 RP:PDB:REP 194->293|2bnlB|9e-08|8.1|99/126| RP:PDB:REP 413->458|1aroP|8e-08|4.3|46/774| RP:PFM:NREP 1 RP:PFM:REP 25->277|PF00664|2e-14|25.0|252/274|ABC_membrane| HM:PFM:NREP 2 HM:PFM:REP 17->278|PF00664|1.9e-26|23.0|257/275|ABC_membrane| HM:PFM:REP 347->432|PF00005|1.1e-10|36.2|80/118|ABC_tran| GO:PFM:NREP 5 GO:PFM GO:0005524|"GO:ATP binding"|PF00664|IPR001140| GO:PFM GO:0006810|"GO:transport"|PF00664|IPR001140| GO:PFM GO:0016021|"GO:integral to membrane"|PF00664|IPR001140| GO:PFM GO:0042626|"GO:ATPase activity, coupled to transmembrane movement of substances"|PF00664|IPR001140| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00664|IPR001140| RP:SCP:NREP 2 RP:SCP:REP 10->309|2hydA2|1e-27|17.2|297/323|f.37.1.1| RP:SCP:REP 412->472|1e69A|1e-06|18.0|61/263|c.37.1.12| HM:SCP:REP 5->422|1pf4A2|5.1e-53|22.3|296/311|f.37.1.1|1/1|ABC transporter transmembrane region| HM:SCP:REP 392->460|1ewqA2|1e-09|35.3|68/224|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 41 OP:NHOMOORG 28 OP:PATTERN ------------------------1------------------------------------------- ----1112333111-----------------------322-1-2--1-----11---1-----1--2-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------1------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 419 STR:RPRED 86.9 SQ:SECSTR ####THHHHHHTccHHHHHHHHHHHHHHHHHHHHHccTTcTTHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccTHHHHccH#HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHccccccTTHHHHHHHHHHHHHHTccHHHHHEHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHTGGGTTEEEETTcHHHHHHHHHHGGGccccccTTGGTccccccTTTTTTHTTccccTTccc##########################################################HccccHHHHHHHHHHHHHHHHTTTcccccTTHHHHHTccHHHHHHHHHHHHHHHHHHHHHEcTTTccTTHH DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEcccccEEEEccEEHHHHcccHHHHHHHHcEEccccHHccccHHHHHHccHHHHHHHHHHHHHHHccHHHccccccccccccHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEccc //