[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54487.1
DDBJ      :             hypothetical protein
Swiss-Prot:ZUPT_CORGL   RecName: Full=Zinc transporter zupT;

Homologs  Archaea  21/68 : Bacteria  235/915 : Eukaryota  115/199 : Viruses  0/175   --->[See Alignment]
:268 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   124->263 PF02535 * Zip 2e-18 42.4 %
:HMM:PFM   7->92 PF02535 * Zip 5e-10 25.9 81/319  
:HMM:PFM   123->262 PF02535 * Zip 3.2e-26 29.0 138/319  
:BLT:SWISS 28->268 ZUPT_CORGL e-116 99.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54487.1 GT:GENE BAF54487.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1656554..1657360 GB:FROM 1656554 GB:TO 1657360 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54487.1 LENGTH 268 SQ:AASEQ MDTSTVLFAFGLTLFAGLATGIGGLIAVSRKTVTEGFLAGSLGFSVGVMLYVSFVEILPGAFDELTSVWGEKGGSWAAVIGFFGGIALIAIIDRLVPTAINPHEPSTVGGAVEGFERRNRMMKMGVLTALAIAIHNFPEGFATFLAGLSDPTIAIPVAVAIAIHNIPEGIAVAVPLREATGSRRKALGWATLSGLAEPAGALIGFLLLMPFIGPEALGLCFAAVAGVMVFISVDELLPTAISSGKHHTAIYGLIAGMAVMAISLLLFI GT:EXON 1|1-268:0| SW:ID ZUPT_CORGL SW:DE RecName: Full=Zinc transporter zupT; SW:GN Name=zupT; OrderedLocusNames=Cgl1434, cg1623; SW:KW Cell membrane; Complete proteome; Ion transport; Membrane;Transmembrane; Transport; Zinc; Zinc transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 28->268|ZUPT_CORGL|e-116|99.2|241/263| GO:SWS:NREP 6 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0006811|"GO:ion transport"|Ion transport| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| GO:SWS GO:0006829|"GO:zinc ion transport"|Zinc transport| TM:NTM 7 TM:REGION 5->27| TM:REGION 37->59| TM:REGION 77->99| TM:REGION 155->177| TM:REGION 187->209| TM:REGION 218->240| TM:REGION 247->268| SEG 7->27|lfafgltlfaglatgigglia| SEG 77->92|aavigffggialiaii| SEG 153->163|iaipvavaiai| RP:PFM:NREP 1 RP:PFM:REP 124->263|PF02535|2e-18|42.4|139/299|Zip| HM:PFM:NREP 2 HM:PFM:REP 7->92|PF02535|5e-10|25.9|81/319|Zip| HM:PFM:REP 123->262|PF02535|3.2e-26|29.0|138/319|Zip| GO:PFM:NREP 4 GO:PFM GO:0016020|"GO:membrane"|PF02535|IPR003689| GO:PFM GO:0030001|"GO:metal ion transport"|PF02535|IPR003689| GO:PFM GO:0046873|"GO:metal ion transmembrane transporter activity"|PF02535|IPR003689| GO:PFM GO:0055085|"GO:transmembrane transport"|PF02535|IPR003689| OP:NHOMO 490 OP:NHOMOORG 371 OP:PATTERN ----1-----------1-------1112-111--1---111-1-----1-211-1---1-----1--- -----1-1111-----------------------------------1---------1---------------------1-1--1-111------------1-------1----------------1-111111--2----------1-1----11-----------1------------------1----1-1-------------------------11111111111111-----------------1111-----------------------------1----11------------------------1111--1111132--22222222212111111-11211---11111--1221-111-1---11---2-----------------------------------------------------------2----------------------------------------------------------------1-----------------------------------1-----------11------11111-------1-1-111-1111-------1---------1------1111------------1-----111----1-----------------------------------11--11-1111111111-1111111111111111111111-----111111111111111111111111-----------------1---------1--1-1111-----------------1---11----111--11111111------------------------1111111-22-------111---------1----1-------------------------111-1111-1--1 ----112-----112111111111111111111111111111111111111111--1-1111-11----11--11------11-2-11----1----------212-2912------1-1--1-------------1-1--11---11-------1-11---1--1-141311211532822221121211153EAED2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,101-123| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc //