[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54490.1
DDBJ      :             hypothetical protein
Swiss-Prot:Y1438_CORGL  RecName: Full=UPF0225 protein Cgl1438/cg1626;

Homologs  Archaea  0/68 : Bacteria  254/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->127 2jq5A PDBj 3e-15 40.9 %
:RPS:SCOP  30->128 2i9wA1  d.17.4.30 * 7e-26 26.5 %
:HMM:PFM   8->25 PF02810 * SEC-C 2.4e-08 50.0 18/21  
:BLT:SWISS 5->129 Y1438_CORGL 8e-73 97.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54490.1 GT:GENE BAF54490.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1659751..1660140) GB:FROM 1659751 GB:TO 1660140 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54490.1 LENGTH 129 SQ:AASEQ MDFELDKRCPCGTGLTYGECCYRFHSGEWVAPTAEALMRSRFTAFAVGNSQYLLDTWDPETRPSELGLDVGIDFYRLDILETTGGGPFDSTGTVKFQAFYKGLASGVQEEDSTFRKVNGAWVYSTGDVD GT:EXON 1|1-129:0| SW:ID Y1438_CORGL SW:DE RecName: Full=UPF0225 protein Cgl1438/cg1626; SW:GN OrderedLocusNames=Cgl1438, cg1626; SW:KW Complete proteome. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 5->129|Y1438_CORGL|8e-73|97.6|125/125| BL:PDB:NREP 1 BL:PDB:REP 9->127|2jq5A|3e-15|40.9|115/128| HM:PFM:NREP 1 HM:PFM:REP 8->25|PF02810|2.4e-08|50.0|18/21|SEC-C| RP:SCP:NREP 1 RP:SCP:REP 30->128|2i9wA1|7e-26|26.5|98/113|d.17.4.30| OP:NHOMO 269 OP:NHOMOORG 265 OP:PATTERN -------------------------------------------------------------------- ----1111111----------1---1------11111111---11-11111111111-----111--111-----------------------------1-11---1---------------------------------------1----------1111--1-------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------11---11111----------------------1-----------------------------------------211-----------------------------------11111---1---1111---1111111---1111--11-111-11-111-11-111111---------1111111-1-11111111-111111-11----11------------------------111--111111111-1-21111-11111111-11----1--1--------111111111111111-1111111111111111111-1111111--111111111-1-111111--111-1------------------------11111----1----1----------------11111--1-1----1------------1111-11111-1111111111111--------------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1311-1111--------1----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 89.1 SQ:SECSTR ########ccccccccHHHHHHHHHTTccccccHHHHHHHHHHHHHTTcHHHHHHTccHHHH#TTccHHHHEEEEEEEEEEEEEET###TEEEEEEEEEEEcccEEEEEEEEEEEEETTEEEEEEEE## DISOP:02AL 1-1| PSIPRED ccccccccccccccccHHHccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccEEEEEEEEEEcccccccEEEEEEEEEEEccccEEEEEEEEEEEEccEEEEEEcccc //