[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54491.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  85/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.69.1d.227.1
:400 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->148 2o2gA PDBj 5e-07 33.3 %
:RPS:PDB   40->263 3ds8A PDBj 1e-10 15.0 %
:RPS:PDB   270->399 2bjoA PDBj 3e-08 10.0 %
:RPS:SCOP  39->253 1ve6A2  c.69.1.33 * 1e-10 15.8 %
:RPS:SCOP  270->400 1n2fA  d.227.1.1 * 2e-08 13.7 %
:HMM:SCOP  1->258 1thtA_ c.69.1.13 * 4.8e-37 25.5 %
:HMM:SCOP  268->400 1vlaA_ d.227.1.2 * 1.7e-16 24.1 %
:RPS:PFM   20->137 PF02129 * Peptidase_S15 5e-08 35.0 %
:HMM:PFM   303->396 PF02566 * OsmC 1.2e-12 24.7 93/99  
:HMM:PFM   49->153 PF02129 * Peptidase_S15 3.2e-09 24.3 103/272  
:HMM:PFM   195->262 PF05729 * NACHT 0.00015 22.1 68/166  
:HMM:PFM   165->208 PF01886 * DUF61 0.00019 38.6 44/132  
:BLT:SWISS 27->136 ABHDA_PONAB 2e-08 35.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54491.1 GT:GENE BAF54491.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1660142..1661344) GB:FROM 1660142 GB:TO 1661344 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54491.1 LENGTH 400 SQ:AASEQ MSKGLLPVHSVSVKVPSSQGLMMAATLDLPDTDPIAYAMFAHCFTGSRFTPAAARVSKTLAESGVACLRFDFPGLGQSEGDFSKTTFNSNVDDIVAASQWLTEHYSAPQLLIGHSLGGAASLKAATKISCLKAVATIGAPFDPAHAVLHFADRICDVDDQGAVTLQLGGRDVTISREFLEDLAEVNPEDHLRRLRKPLLLLHSPTDQTVGVDNAQLIFRVTRYPKSLMTLDKADHLLTKDGTAQRAARIIANWVEPYLVPENVCEDLPEFVAEASTIKASKYGAAIRTGGHNFITDRDKSQGGKNLGFTPTSLLVSALAAANSQTIKQTAIDNRIKGLDDVKVTISQEQSADHGQIKLRRKISLIGNLSDADSASLRAASNSCSITQLLAQGIVIDDEVN GT:EXON 1|1-400:0| BL:SWS:NREP 1 BL:SWS:REP 27->136|ABHDA_PONAB|2e-08|35.5|107/306| SEG 7->18|pvhsvsvkvpss| SEG 191->201|lrrlrkpllll| SEG 312->323|sllvsalaaans| SEG 367->382|nlsdadsaslraasns| BL:PDB:NREP 1 BL:PDB:REP 39->148|2o2gA|5e-07|33.3|108/214| RP:PDB:NREP 2 RP:PDB:REP 40->263|3ds8A|1e-10|15.0|207/245| RP:PDB:REP 270->399|2bjoA|3e-08|10.0|130/135| RP:PFM:NREP 1 RP:PFM:REP 20->137|PF02129|5e-08|35.0|117/238|Peptidase_S15| HM:PFM:NREP 4 HM:PFM:REP 303->396|PF02566|1.2e-12|24.7|93/99|OsmC| HM:PFM:REP 49->153|PF02129|3.2e-09|24.3|103/272|Peptidase_S15| HM:PFM:REP 195->262|PF05729|0.00015|22.1|68/166|NACHT| HM:PFM:REP 165->208|PF01886|0.00019|38.6|44/132|DUF61| GO:PFM:NREP 2 GO:PFM GO:0004177|"GO:aminopeptidase activity"|PF02129|IPR000383| GO:PFM GO:0006508|"GO:proteolysis"|PF02129|IPR000383| RP:SCP:NREP 2 RP:SCP:REP 39->253|1ve6A2|1e-10|15.8|203/260|c.69.1.33| RP:SCP:REP 270->400|1n2fA|2e-08|13.7|131/142|d.227.1.1| HM:SCP:REP 1->258|1thtA_|4.8e-37|25.5|231/0|c.69.1.13|1/1|alpha/beta-Hydrolases| HM:SCP:REP 268->400|1vlaA_|1.7e-16|24.1|133/144|d.227.1.2|1/1|OsmC-like| OP:NHOMO 92 OP:NHOMOORG 89 OP:PATTERN -----------------------1-------------------------------------------- ----11111111--1------1--11------1-----------1--------11------------------------------------------------11---1---------------1----------------------------------------------------------1----11------------------------------------------1---------------------------------------------------------------------------------------------1---------------------------------1-----111------1-----------11111111111----------------------1-------1--111--1-111-----111--------------1-------------------------------1-1-------1----1------------------------------------1-11--1-1------------------1-1---------1-1--1-------1--1---------------------------------1--1-------------------1---1-11--------------------------------------------------------------------------------------------------1111--------------------------------1111-----------------------------------------------------------------------------------------------------------1-- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------2----3-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 94.5 SQ:SECSTR ###################ccEEEEEEEcTTccEEEEEEEEccTTccTTTGHTHHHHHHHTTcccccEEEEEETTTEEEEEccccTTcccHHHHHHHHHHHHHHHcccEEEEEETHHHHHHHHHHHHccEEEEEEEEcccTTcccHHHHcHHHHHHHHHHTcccTTccccccccHHHHHHHTGGGccTTcEEEEEEEEccTTccccccccHHHHTGGGTccEEEEEEEEcGGGcGcTGGGGGcHHHHHHHHHHHHTccccccEHHH###ccccEEEEcGGGcEEEETTcccEEEcccTTTTTTTcccccHHHHHHHHHHHHHHHHHHHHHHTTTcccccEEEEEEEEEEETTTTEEEEEEEEEcTTccHHHHHHHHHHHHHHcHHHHHHTTTcccEEEEE DISOP:02AL 1-7,264-280,302-302| PSIPRED ccccccccEEEEEEEEcccccEEEEEEEcccccccEEEEEEcccccccccHHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHHcccccHHcccccccccHHHHHHHHHccHHHHHHHccccEEEEEEcccccccHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEcccEEEEEcccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHccccHHHHHccccEEEEEEc //