[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54496.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  75/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:191 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   28->114 3d70A PDBj 1e-12 20.0 %
:RPS:SCOP  32->114 1jbgA  a.6.1.3 * 2e-09 23.8 %
:HMM:SCOP  32->134 1q06A_ a.6.1.3 * 5.1e-12 27.0 %
:HMM:PFM   37->66 PF00376 * MerR 0.00051 30.0 30/38  
:BLT:SWISS 16->189 Y1861_MYCBO 5e-63 74.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54496.1 GT:GENE BAF54496.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1666117..1666692 GB:FROM 1666117 GB:TO 1666692 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54496.1 LENGTH 191 SQ:AASEQ MYEDKNYQGEIFNGVPVQETLFEVGPDEQVGYRVPTACQVAGITYRQLDYWARTKLVVPTIRGARGSGSQRLYSFKDILVLKIVKRLLDTGISLQNIRLAVDKLRDMGTNDLAEITLVSDGTTVYECRSNEEVIDLLGGGQGVFGIAVPGIMKELTGDISSFPSERIDEEFQAETINFQDELAARRSRRTS GT:EXON 1|1-191:0| BL:SWS:NREP 1 BL:SWS:REP 16->189|Y1861_MYCBO|5e-63|74.7|170/225| RP:PDB:NREP 1 RP:PDB:REP 28->114|3d70A|1e-12|20.0|85/276| HM:PFM:NREP 1 HM:PFM:REP 37->66|PF00376|0.00051|30.0|30/38|MerR| RP:SCP:NREP 1 RP:SCP:REP 32->114|1jbgA|2e-09|23.8|80/106|a.6.1.3| HM:SCP:REP 32->134|1q06A_|5.1e-12|27.0|100/127|a.6.1.3|1/1|Putative DNA-binding domain| OP:NHOMO 75 OP:NHOMOORG 75 OP:PATTERN -------------------------------------------------------------------- --1-111111111111111-1111111111111111111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 85 STR:RPRED 44.5 SQ:SECSTR ###########################ccccEEHHHHHHHHTccHHHHHHHHHTTcccccEE##cTTTccEEEcGGGGGHHHHHHHHHHHTccHHHHHHHTTccHHHHHHHHHH############################################################################# DISOP:02AL 1-4,184-184,187-192| PSIPRED cccccccccccccccccHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHcccEEEEcccccccccEEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccc //