[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54506.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  133/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:154 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   66->153 1o0iA PDBj 3e-12 39.8 %
:RPS:PDB   34->144 3e1eC PDBj 4e-17 16.2 %
:RPS:SCOP  42->144 1zkiA1  d.38.1.5 * 2e-19 21.4 %
:HMM:SCOP  28->152 1zkiA1 d.38.1.5 * 5.4e-26 28.8 %
:HMM:PFM   69->137 PF03061 * 4HBT 1.5e-15 30.4 69/79  
:BLT:SWISS 33->148 Y1847_MYCTU 6e-14 36.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54506.1 GT:GENE BAF54506.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1676261..1676725 GB:FROM 1676261 GB:TO 1676725 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54506.1 LENGTH 154 SQ:AASEQ MTSRDDQPQDLLSLAELAATRALTTDELEALNNANYGLDRNLGLRYTTIEPGHVVSELHVASKHLQVVGLVNGGVYAAIAESTGSVASMISAPGKMVVGINNNTDFISAVSSGVIVAEATPIQLGGRTHLWQIECTHRGEVVARTTLRTMVLNK GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 33->148|Y1847_MYCTU|6e-14|36.2|116/140| SEG 11->31|llslaelaatralttdeleal| BL:PDB:NREP 1 BL:PDB:REP 66->153|1o0iA|3e-12|39.8|88/135| RP:PDB:NREP 1 RP:PDB:REP 34->144|3e1eC|4e-17|16.2|111/141| HM:PFM:NREP 1 HM:PFM:REP 69->137|PF03061|1.5e-15|30.4|69/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 42->144|1zkiA1|2e-19|21.4|103/126|d.38.1.5| HM:SCP:REP 28->152|1zkiA1|5.4e-26|28.8|125/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 137 OP:NHOMOORG 134 OP:PATTERN -------------------------------------------------------------------- -----11111111211111-11--1111111111111221--------------------11----------------------------------1---------111-----------------1-1111-1-1---11---1--------------------------------------1--11-------------------------------------11111------------------------------1------------1-----------------------------------------------------------------------------1-----------------------------------------1-111----------------------------------------------------------------------------------------------------------------------------------------------1111-1111----------------11------1--------------------1-----------------------------------111-------1----------------------------------111--1111111111-1-111111-111111111----1-----------------------1----------------------11111------------111111111--1----------------------------------------111-----11111------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 78.6 SQ:SECSTR #################################TTcHHHHHHTcEEEEEETTEEEEEEEccGGGccTTccccHHHHHHHHHHHHHHHHTTccTTcEEEEEEEEEEEcccccccEEEEEEEEEEEcccEEEEEEEEEEEccccEEEEEEEEccEH DISOP:02AL 1-10| PSIPRED ccccccccHHcccHHHHHHHccccHHHHHHHHHHHccHHHHccEEEEEEEccEEEEEEEEcHHHHccccEEHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEEccccccEEEEEEEEEEcccEEEEEEEEEEEccEEEEEEEEEEEEEcc //