[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54515.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:234 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   20->222 3ddhB PDBj 2e-17 21.0 %
:RPS:SCOP  20->224 2gfhA1  c.108.1.6 * 4e-12 21.0 %
:HMM:SCOP  19->225 1ek1A1 c.108.1.2 * 1.3e-14 27.4 %
:HMM:PFM   20->181 PF00702 * Hydrolase 3.9e-09 22.4 161/192  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54515.1 GT:GENE BAF54515.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1683291..1683995) GB:FROM 1683291 GB:TO 1683995 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54515.1 LENGTH 234 SQ:AASEQ MMNASSISSRFKDLFVTPSIVFDFDGTLAIGHGPVLAYALCVAPEGSKDFLERVRRELRRYDDGQSIYRDGYDIVAKLASELGIDDGTMSVAYGESRKLLGSDLAPVEHVRGIKDILSSLKGHARLVLATNAPENGVHDLLRQWGVADLFDQLHFVVGKPAGLISIISDLQLDGPVLAVGDIYEFDLSPAAQLGADTALVGATATISEAKVSMRGDSIADLPLLAWVSSRVSSS GT:EXON 1|1-234:0| RP:PDB:NREP 1 RP:PDB:REP 20->222|3ddhB|2e-17|21.0|200/217| HM:PFM:NREP 1 HM:PFM:REP 20->181|PF00702|3.9e-09|22.4|161/192|Hydrolase| RP:SCP:NREP 1 RP:SCP:REP 20->224|2gfhA1|4e-12|21.0|200/243|c.108.1.6| HM:SCP:REP 19->225|1ek1A1|1.3e-14|27.4|201/0|c.108.1.2|1/1|HAD-like| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------111--------------------------------------1-------1-----------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 89.7 SQ:SECSTR ###################EEEcccTTTHHHHHHHHHHHHTGGGccHHHHHHHHHHHHHTHHHHcccHHHHHHHHHHHHHHTTTcccHHHHHHHHHHHHHHHHTTcccccTTHHHHHHHHHTccEEEEEEEccHHHHHHHHHHHTcGGGccEEEEccccHHHHHHHHHHTTccGGGEEEEccHHHHTHHHHHHTcEEEEcccccccccTcTEEEcccGGGHHHHHHccH##### DISOP:02AL 1-9,233-235| PSIPRED cccHHHHHHHHHHHHHHHHHHccccccEEEccccHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHcHHHHHcEEEEEccccHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHcccEEEEEcccccccHHHHHHHcccccccHHHHHHHHHHHcc //