[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54528.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:63 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->54 PF09976 * DUF2133 2.3e-05 40.0 25/43  
:BLT:SWISS 10->54 Y5204_STRCO 5e-04 28.9 %
:TM
:REPEAT 2|9->26|28->48

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54528.1 GT:GENE BAF54528.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1699219..1699410) GB:FROM 1699219 GB:TO 1699410 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54528.1 LENGTH 63 SQ:AASEQ MMASRMIPALWFRLIVLIGFTGFVLWESMWIFVLIGLLLIAVSGWQLWTAYKTRDEVEKQRNT GT:EXON 1|1-63:0| BL:SWS:NREP 1 BL:SWS:REP 10->54|Y5204_STRCO|5e-04|28.9|45/100| TM:NTM 2 TM:REGION 1->23| TM:REGION 27->49| NREPEAT 1 REPEAT 2|9->26|28->48| HM:PFM:NREP 1 HM:PFM:REP 30->54|PF09976|2.3e-05|40.0|25/43|DUF2133| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,56-64| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcc //