[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54532.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  433/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
c.68.1
:270 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   10->225 2bo4A PDBj 2e-26 19.2 %
:RPS:SCOP  10->225 2bo4A1  c.68.1.18 * 2e-26 19.2 %
:HMM:SCOP  9->223 1xhbA2 c.68.1.17 * 4e-41 35.4 %
:RPS:PFM   12->159 PF00535 * Glycos_transf_2 8e-15 40.3 %
:HMM:PFM   12->175 PF00535 * Glycos_transf_2 4.3e-30 30.4 161/169  
:BLT:SWISS 12->221 DPM1_SCHPO 2e-36 41.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54532.1 GT:GENE BAF54532.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1701455..1702267) GB:FROM 1701455 GB:TO 1702267 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54532.1 LENGTH 270 SQ:AASEQ MSSEAVDATTLVIIPTYNELENLPLIVDRVRTATPDVHVLIVDDNSPDGTGERADKLAADDDHIFVLHREGKGGLCAAYMAGFQWGLERDYQVLCEMDADGSHAPEQLHLLLAEITNGADLVIGSRYVPGGRVVNWPKNRWLLSKGGNVYISVALGAGLTDMTAGYRAFRREVLEALPLDELSNAGYIFQVEIAYRAVEAGFDVREVPITFTEREIGESKLDGSFVKDSLLEVTKWGLKHRGGQAKELSKEMVGLLNYEWKHFKKRNTWL GT:EXON 1|1-270:0| BL:SWS:NREP 1 BL:SWS:REP 12->221|DPM1_SCHPO|2e-36|41.3|206/236| RP:PDB:NREP 1 RP:PDB:REP 10->225|2bo4A|2e-26|19.2|208/380| RP:PFM:NREP 1 RP:PFM:REP 12->159|PF00535|8e-15|40.3|139/148|Glycos_transf_2| HM:PFM:NREP 1 HM:PFM:REP 12->175|PF00535|4.3e-30|30.4|161/169|Glycos_transf_2| RP:SCP:NREP 1 RP:SCP:REP 10->225|2bo4A1|2e-26|19.2|208/380|c.68.1.18| HM:SCP:REP 9->223|1xhbA2|4e-41|35.4|212/0|c.68.1.17|1/1|Nucleotide-diphospho-sugar transferases| OP:NHOMO 1129 OP:NHOMOORG 680 OP:PATTERN 11111--111212231-122211332232413234111212214427623645244454431112-11 2391B11121112121222-22115322222453332254254312111212222112224431514422112111121-2-211122112211222--12222134311---------------3312122223175576-11742533335111111212211-14433121111122121--------21------1--1-1--11-1------2211--1--11----1--------------------1----------------------1111111111111-----------111-111111111111111111----41-----------1-----1--1---3-2-11-1221-11---1---116---1-------11222112211-----------------1---1--2--211-221---2111----1-----1111111111111212------------------------------21--2-------------------2--------------------221--1-1---1-------------11212-121611-1-2311-135425453222322524-1----------------------11111--------11------1---------1----1--1--------12-111111111111-1111111111111111111---111111-1111111111111121-11111--111111111-11----221221111--1---------------------------11-----111-------11---------------------1--22--------1111--42323311-----------------------------------------------3- 11-111--311111111111111111-11111111111111111111111111111111111111111-1122211111111111111-1121122111112111112212111111--111112113-6A1-3121-111-11211-1-1-24-11111311211111111121111171111111321111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 260 STR:RPRED 96.3 SQ:SECSTR ########EcEEEEEcccccHHHHHHHHHHHHHcTTccEEEEEEccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHc#cccccEEEEccTTccccHHHHHHHHHHHHTTccEEEEcccTTccHHHHHTHHHHHHHHHHHHHcTTccGGGcccTTcccEEEEHHHHHHHHHcHHHHccTTHHHHHHHHHHHTTccEEEEEcTTcccccccccGGGGHHHHHHHHHTTccccccccEEccccEEccccccccHHHHcccGGG# DISOP:02AL 1-5,8-8| PSIPRED cccccccccEEEEEEcccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEHHHHHHccccccccccccHHHHHHHHHHHccccEEEEEEEEEEccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //