[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54550.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  111/915 : Eukaryota  110/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:278 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->266 1i9gA PDBj 4e-80 55.2 %
:RPS:PDB   6->263 2b25A PDBj 3e-13 34.3 %
:RPS:SCOP  4->267 1i9gA  c.66.1.13 * e-101 59.9 %
:HMM:SCOP  5->263 2b25A1 c.66.1.13 * 1.3e-69 36.2 %
:RPS:PFM   6->239 PF08704 * GCD14 1e-35 37.9 %
:HMM:PFM   7->241 PF08704 * GCD14 5.1e-27 26.0 231/309  
:BLT:SWISS 15->262 TRMI_THET2 2e-35 35.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54550.1 GT:GENE BAF54550.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1723062..1723898) GB:FROM 1723062 GB:TO 1723898 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54550.1 LENGTH 278 SQ:AASEQ MPYSGPFQAGDRVQLTDAKRRHFTIILEPGTTYHTHRGQIAHDDIIGADEGTVVHSTMGSDYLCFRHLMVDHVLSMPRGAAVIYPKDSAQILVEGDIFPGARVLEAGAGSGALSMSLLRAVGEKGNVISYEIREDHLEYAVSNVEEYFGERPATWDPRLGDLKEVTVEDLGGPVDRIILDMLEPWEMLETCKDLLIPGGVFMTYVATVPQLMKVMEGIREQKCFTEPRAWESLVRDWKVEGLATRPEHRMNAHTAFLVLTRRLADGVEPPRPQRKARR GT:EXON 1|1-278:0| BL:SWS:NREP 1 BL:SWS:REP 15->262|TRMI_THET2|2e-35|35.0|243/255| BL:PDB:NREP 1 BL:PDB:REP 4->266|1i9gA|4e-80|55.2|261/264| RP:PDB:NREP 1 RP:PDB:REP 6->263|2b25A|3e-13|34.3|251/254| RP:PFM:NREP 1 RP:PFM:REP 6->239|PF08704|1e-35|37.9|232/243|GCD14| HM:PFM:NREP 1 HM:PFM:REP 7->241|PF08704|5.1e-27|26.0|231/309|GCD14| GO:PFM:NREP 2 GO:PFM GO:0016429|"GO:tRNA (adenine-N1-)-methyltransferase activity"|PF08704|IPR014816| GO:PFM GO:0030488|"GO:tRNA methylation"|PF08704|IPR014816| RP:SCP:NREP 1 RP:SCP:REP 4->267|1i9gA|e-101|59.9|262/265|c.66.1.13| HM:SCP:REP 5->263|2b25A1|1.3e-69|36.2|257/0|c.66.1.13|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 320 OP:NHOMOORG 277 OP:PATTERN 111111111111111111111111---1-11111111111111-1-1--1---111111111111-11 ---1111111111111111-1111111111111111111111111111111111111111111111111111111111-----11111--------------------------------------------------------------------------------------------------11-1-------------------------------------------------------------------------------------------------------------------------------------1-------------------------------1------11--1111----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111111----------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1111111--- 1111111-1-1-1111-----------------------------------------------11111-1111111111111111111-111-1-11111-1-221--2-21222212-1--2111-514A2-223----2-211111112-1112222--1-111--11411121----1-1-------1-111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 275 STR:RPRED 98.9 SQ:SECSTR ###cccccTTcEEEEEccccEEEEEEccccccccccHcccccHHHTTccTTEEEEcTTccEEEEEcccHHHHHHHcccccccccHHHHHHHHHHHTccTTcEEEEEccTTcHHHHHHHHHHcTTcEEEEEEccHHHHHHHHHHHHHHHHHHTTTcccccccEEEEEccTTcccEEEEEEccccTTTTHHHHGGGEEEEEEEEEEEccHHHHHHHHHHHHHTccEEEEEEEccccccEcEEcccEEEcccccccccEEEEEEEcccTTEEEEEEcGGHH DISOP:02AL 1-1,274-279| PSIPRED cccccccccccEEEEEEccccEEEEEEccccEEcccccEEEHHHHcccccccEEEEEcccEEEEEcccHHHHHHHccccccccccHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHccccccEEEEEEccHHHcccccccccccEEEEccccHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHcccccccEEEEEEEEEEEEEEcccccccccEEEEEEEEEEEEcccccccccccccccc //