[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54558.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  555/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:231 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->186 2pibA PDBj 3e-13 28.7 %
:RPS:PDB   2->186 3d6jA PDBj 2e-27 20.6 %
:RPS:SCOP  2->186 2hszA1  c.108.1.6 * 2e-34 25.4 %
:HMM:SCOP  1->189 1fezA_ c.108.1.3 * 6.3e-47 37.0 %
:RPS:PFM   5->147 PF00702 * Hydrolase 5e-05 29.6 %
:HMM:PFM   2->174 PF00702 * Hydrolase 4.6e-22 22.7 172/192  
:BLT:SWISS 7->184 GS1_DROME 2e-19 34.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54558.1 GT:GENE BAF54558.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1731308..1732003) GB:FROM 1731308 GB:TO 1732003 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54558.1 LENGTH 231 SQ:AASEQ MIKAIFWDMDGTMVDSEPQWGIATYELSEAMGRRLTPELRELTVGSSLPRTMRLCAEHAGITLSDADYERYRAGMFARVHELFDESLVPNPGVTELLTELKALEIPMLVTTNTERDLATRSVAAVGNEFFIGSIAGDEVPTAKPAPDMYLEAARRVGFDPSECLVFEDSYNGMLGAVTAGCRVIGLHPEEVQAPEGVVPLRSLHGKNSFEGVTAEMVTSWYHQIEPAGVAK GT:EXON 1|1-231:0| BL:SWS:NREP 1 BL:SWS:REP 7->184|GS1_DROME|2e-19|34.7|173/231| BL:PDB:NREP 1 BL:PDB:REP 10->186|2pibA|3e-13|28.7|167/210| RP:PDB:NREP 1 RP:PDB:REP 2->186|3d6jA|2e-27|20.6|180/206| RP:PFM:NREP 1 RP:PFM:REP 5->147|PF00702|5e-05|29.6|142/195|Hydrolase| HM:PFM:NREP 1 HM:PFM:REP 2->174|PF00702|4.6e-22|22.7|172/192|Hydrolase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00702|IPR005834| GO:PFM GO:0008152|"GO:metabolic process"|PF00702|IPR005834| RP:SCP:NREP 1 RP:SCP:REP 2->186|2hszA1|2e-34|25.4|185/224|c.108.1.6| HM:SCP:REP 1->189|1fezA_|6.3e-47|37.0|189/256|c.108.1.3|1/1|HAD-like| OP:NHOMO 1186 OP:NHOMOORG 654 OP:PATTERN --------1111111----------------------------------1-12--1------------ -33-11111111111------1---1------111121111311212122311123-1--2212231335221112221--11--------211-----1151111-3-1----------------1-12--1-1211111111123122--12211-1121-1-113123------------41111111121111--11--1-111-1-11111111--1-1-2222211--1111111111111-111112----1-----------2-----111111--------------------------------11---11111--44111111121211111111312---11--------2---112----1-222211----2-535-1-3132322222222223-31222131231-233223213233----1111343311111111111-221-111------------------------------------2211-2212-222221122222223213-1-1-111222121122133111-2212-11-111-1-1---1-----21-------112-3---1----12-11-----------------------1--4341-2-1111122131212223-111311---12--------53232334555445555-554556555555433433632444-132322222221222222323355521-333333323333-------------2-111222211-111111111-11111---1-2222113121122-453-111111111-123222222232421222222221111--1-11-----------------------------------------21--11111111 -----------211--122--1---------------------11-1---------11111111----------------------1--2111132-1-1-1-211-23--11-11--1---1-11-11131--1111--1--1---------1-1121-----11-511-11--1541A11-5254791541222114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 88.7 SQ:SECSTR TccEEEEcccTTTEEcHHHHHHHHHHHHHHTTcccccHHHHTTTTccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHGGGcHHHHTEEcTTHHHHHHHHHHHTcEEEEEccccHHHHHHHHHTccTTcccEEEcGGGccccTTcTHHHHHHHHHTTccGGGEEEEEccHHHHHHHHHHTcEEEEEccccccccTTEEEcccGGT########################## DISOP:02AL 228-232| PSIPRED cccEEEEcccccccccHHHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //