[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54563.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  65/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.44.1
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->130 1lk0A PDBj 2e-10 30.6 %
:RPS:PDB   3->134 2cd7A PDBj 3e-19 26.6 %
:RPS:SCOP  3->134 1jf8A  c.44.1.1 * 3e-18 26.6 %
:HMM:SCOP  1->136 1p8aA_ c.44.1.1 * 3.4e-26 29.5 %
:HMM:PFM   6->134 PF01451 * LMWPc 2.7e-23 29.5 129/140  
:BLT:SWISS 2->130 ARSC1_STAHJ 4e-10 32.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54563.1 GT:GENE BAF54563.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1739031..1739453 GB:FROM 1739031 GB:TO 1739453 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54563.1 LENGTH 140 SQ:AASEQ MIDQPSVLFVCVGNGGKSQMAAALAKKHAGDALEIHSAGTKPGTKLNQQSLESIAEVGADMSQGFPKGIDLDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRLVRDDIDARVQNLIAELTQNA GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 2->130|ARSC1_STAHJ|4e-10|32.0|125/133| SEG 21->33|aaalakkhagdal| BL:PDB:NREP 1 BL:PDB:REP 3->130|1lk0A|2e-10|30.6|124/130| RP:PDB:NREP 1 RP:PDB:REP 3->134|2cd7A|3e-19|26.6|128/131| HM:PFM:NREP 1 HM:PFM:REP 6->134|PF01451|2.7e-23|29.5|129/140|LMWPc| RP:SCP:NREP 1 RP:SCP:REP 3->134|1jf8A|3e-18|26.6|128/130|c.44.1.1| HM:SCP:REP 1->136|1p8aA_|3.4e-26|29.5|132/146|c.44.1.1|1/1|Phosphotyrosine protein phosphatases I| OP:NHOMO 110 OP:NHOMOORG 70 OP:PATTERN ------------------------------1------------------------------------1 --1-21-43331-132-11-13--1111111-31315414-2211111211-412-2----21-1--1211------------1--1--------------------------------------1--1------------11-----------------------------------------1----------------------------------1------------1------------------------------------------------------------------------------------------1---------------------------------1----1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------21-----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 136 STR:RPRED 97.1 SQ:SECSTR ccccEEEEEEETTcccHHHHHHHHHHHHcTTTEEEEEEEcccTccccHHHHHHHHHTTcccTTcccccccHHHHHHccEEEEccHHHHHTccccTTccEEEccccccTTccHHHHHHHHHHHHHHHHHHHHHHTHH#### DISOP:02AL 1-2,139-141| PSIPRED cccccEEEEEEcccccHHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHHccccHHccccccccHHHHHHccEEEEEcccccHHccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //