[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54572.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:162 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 67->152 YCDU_ECOLI 2e-04 30.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54572.1 GT:GENE BAF54572.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1747217..1747705) GB:FROM 1747217 GB:TO 1747705 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54572.1 LENGTH 162 SQ:AASEQ MAGQLCGDGTRTSRVCHIMSSASGRSLKKLTSLEGRASWRKVPAAIRIGGAFVALGLVLLVFAAIELFTAGMLSPFVITPGFLLILVASIILGAFATTSKYEPSSKTQIISLSIAVALVIVSRLLPTIQVYVVEQFWLTAWGVAALLCGLVIRRAQLPKSTK GT:EXON 1|1-162:0| BL:SWS:NREP 1 BL:SWS:REP 67->152|YCDU_ECOLI|2e-04|30.2|86/100| TM:NTM 4 TM:REGION 44->66| TM:REGION 75->96| TM:REGION 107->129| TM:REGION 131->152| SEG 49->64|ggafvalglvllvfaa| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,24-26,159-163| PSIPRED ccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //