[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54581.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  194/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
:254 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   99->216 PF09335 * SNARE_assoc 2e-08 33.6 %
:HMM:PFM   100->217 PF09335 * SNARE_assoc 5.9e-24 33.9 118/123  
:BLT:SWISS 74->242 Y1528_MYCBO 4e-31 40.1 %
:PROS 76->101|PS01159|WW_DOMAIN_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54581.1 GT:GENE BAF54581.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1759594..1760358 GB:FROM 1759594 GB:TO 1760358 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54581.1 LENGTH 254 SQ:AASEQ MHDKGETQENPADTSGRLNTPISTVFHFFSSLFHDALRSVAQWSAWKKIAVSVVIVAIISVTFLVNVPPISVYRDWANNAGDAFVLVFCAFYILITQFPIPRTVLTLASGVLFGPVLGSFVALGSTTVSAVISLLIVRGLLGDWMAPRLTHPAVSRINNRLEQRGWLAITSLRMIAAIPFSILNYVAALTSVPVFSFAIATLIGSAPGTIITVVLGDAVTGSGNWTAVAFTIFLAILGVLGIFLDQKMPVKPGK GT:EXON 1|1-254:0| BL:SWS:NREP 1 BL:SWS:REP 74->242|Y1528_MYCBO|4e-31|40.1|167/252| PROS 76->101|PS01159|WW_DOMAIN_1|PDOC50020| TM:NTM 6 TM:REGION 49->71| TM:REGION 78->100| TM:REGION 114->136| TM:REGION 163->185| TM:REGION 194->216| TM:REGION 226->248| SEG 49->61|iavsvvivaiisv| RP:PFM:NREP 1 RP:PFM:REP 99->216|PF09335|2e-08|33.6|116/119|SNARE_assoc| HM:PFM:NREP 1 HM:PFM:REP 100->217|PF09335|5.9e-24|33.9|118/123|SNARE_assoc| OP:NHOMO 238 OP:NHOMOORG 207 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11--1111111121111112------1---------------1--1--1---------------------------------------------------------------------------1-3121111----11-1-111--123--11------1-------------------------1---1--11--------21--------------------------------------------------------------------------------------------------11-1-1112122-1------111----3-----11--11----11-1---1-2----------------------------------11-11-1-----------1---------1-1-----1-1---------------1----------------------------------------------2----11-1-------1--1--------------------1-1--------------11---1-3111-11--1--1-1--31------------------------------1-----11-111--1---1----1---------------12-1----------1--1111111111-1111111111111111111111----------------------1111111-----------------------1111-11------------------------1-----------1-----1--------------2211111122-11----------------2------------------------------------------------------1- ----11------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------1--121-1-113---2-----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15,252-255| PSIPRED ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc //