[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54585.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  60/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:281 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->270 PF11296 * DUF3097 3e-65 54.4 %
:HMM:PFM   6->271 PF11296 * DUF3097 1.1e-120 56.3 261/275  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54585.1 GT:GENE BAF54585.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1763287..1764132) GB:FROM 1763287 GB:TO 1764132 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54585.1 LENGTH 281 SQ:AASEQ MSFSDPYAGNIFGGHSRNKQPEHPDVPAKPGLVVEVRGDGFVGAVTGFERTYDGDFVRLEDRRGRDALYKLRKGAFMIDGQIVNLTRFVEKQAPRKSNSGSRRVENVQAKVAAPSRIWVEGIHDAAIVEKVWGHDLRVEGVVVEYLEGLDNLEERLAEFQPGPGRRIGVLADHLVEGSKETRMTKSLPADVAVTGHPYIDIWAAVKPERLGLKEWPKVPYGEDWKTGICKRVGWSDPKEGWHRVYNAVNSFRDLDYTLIGAVERLVDFVTNHDLSKEDVLA GT:EXON 1|1-281:0| SEG 138->149|vegvvveylegl| RP:PFM:NREP 1 RP:PFM:REP 7->270|PF11296|3e-65|54.4|259/272|DUF3097| HM:PFM:NREP 1 HM:PFM:REP 6->271|PF11296|1.1e-120|56.3|261/275|DUF3097| OP:NHOMO 60 OP:NHOMOORG 60 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11--1111111111111111-11111111111111111--1111111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,17-26,89-106| PSIPRED cccccccccccccccccccccccccccccccEEEEEccccEEEEEEEEEEcccccEEEEEcccccEEEEEcccccEEEcccEEEEEEccccccccccccccEEcccccEEEEcccEEEEEEccHHHHHHHHHccccEEEEEEEEEccccccHHHHHHHcccccccEEEEEHHHHccccHHHHHHccccccEEEEccccHHHHHHccHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHcc //