[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54589.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:166 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   132->158 PF12555 * TPPK_C 0.00047 29.6 27/53  
:HMM:PFM   21->90 PF07931 * CPT 0.00085 28.8 66/174  
:PROS 1->88|PS00430|TONB_DEPENDENT_REC_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54589.1 GT:GENE BAF54589.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1768488..1768988) GB:FROM 1768488 GB:TO 1768988 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54589.1 LENGTH 166 SQ:AASEQ MIPENIDLKQLASELGDDAVAMGEHTGNQFPTLEKDLINVVADAKESDFGSLGVVILDETPVMTSDLRDIAQELLIQTDLDTVVVRAPMSAAVVSDVHSRAALESGQHDLLGTTDYVLGTELLVQDVTESTVGNIDWGQLLIWGLVALAIAVVVAGVSVRRKAISL GT:EXON 1|1-166:0| PROS 1->88|PS00430|TONB_DEPENDENT_REC_1|PDOC00354| TM:NTM 1 TM:REGION 138->159| SEG 140->157|lliwglvalaiavvvagv| HM:PFM:NREP 2 HM:PFM:REP 132->158|PF12555|0.00047|29.6|27/53|TPPK_C| HM:PFM:REP 21->90|PF07931|0.00085|28.8|66/174|CPT| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----1-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccccccHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHccc //