[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54594.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:70 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   53->65 PF08129 * Antimicrobial17 6.6e-05 69.2 13/57  
:BLT:SWISS 6->69 YXLE_BACSU 6e-06 32.2 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54594.1 GT:GENE BAF54594.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1774413..1774625) GB:FROM 1774413 GB:TO 1774625 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54594.1 LENGTH 70 SQ:AASEQ MRADWLDLPTELRFPVIAVAIAEFATKVSVWVSLSRRAPEKVRGPKWVWALLTIVNGVGPAAYWAFGRKN GT:EXON 1|1-70:0| BL:SWS:NREP 1 BL:SWS:REP 6->69|YXLE_BACSU|6e-06|32.2|59/100| TM:NTM 2 TM:REGION 13->35| TM:REGION 45->67| HM:PFM:NREP 1 HM:PFM:REP 53->65|PF08129|6.6e-05|69.2|13/57|Antimicrobial17| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1-11-------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,70-71| PSIPRED ccccHHcccHHHHHHHHHHHHHHHHHHHHEEEEEEEccccccccHHHHHHHHHHHHcccHHHHHHHcccc //