[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54598.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:171 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   70->165 2r6aB PDBj 8e-04 31.2 %
:RPS:SCOP  86->164 1lj8A4  c.2.1.6 * 8e-05 30.9 %
:RPS:PFM   37->169 PF09348 * DUF1990 5e-19 38.6 %
:HMM:PFM   16->169 PF09348 * DUF1990 3.6e-46 40.1 147/158  
:BLT:SWISS 19->158 U548_DICDI 7e-13 35.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54598.1 GT:GENE BAF54598.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1779305..1779820) GB:FROM 1779305 GB:TO 1779820 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54598.1 LENGTH 171 SQ:AASEQ MDYGTLEKMKTSALSYPESLHGKSEDLLNSNFEVAKGWQITDRKLVLGYGEECFQNAVQQLFSWKAHQYAGITVTQTNTTVELKFWGIRSYCRILKSHQGLRRAVLIYGTLEKHVERGEEAFEIRMADNGQVTAHIVAFSKPAKWWAKLANPTVRWVQLRITDKYLEGLKS GT:EXON 1|1-171:0| BL:SWS:NREP 1 BL:SWS:REP 19->158|U548_DICDI|7e-13|35.3|139/216| BL:PDB:NREP 1 BL:PDB:REP 70->165|2r6aB|8e-04|31.2|93/374| RP:PFM:NREP 1 RP:PFM:REP 37->169|PF09348|5e-19|38.6|132/156|DUF1990| HM:PFM:NREP 1 HM:PFM:REP 16->169|PF09348|3.6e-46|40.1|147/158|DUF1990| RP:SCP:NREP 1 RP:SCP:REP 86->164|1lj8A4|8e-05|30.9|68/286|c.2.1.6| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- -------1111---1---------1------11----111------1----------1---1------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 54.4 SQ:SECSTR #####################################################################ccEEEEcccc###ccHHHHHHHHHHHHHHTcccEEEEEcHHHHHHHHHHHHHHTccEEEEEEccccEEEEccEEEEEEEEccccccEEEEEEETTT###### DISOP:02AL 1-8,170-172| PSIPRED ccHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEEccccccEEEEEEEccccEEEEEEEEcccccccccEEEEEEEccccEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //