[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54643.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  873/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
d.130.1
:152 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->151 1p7lA PDBj 1e-53 70.7 %
:RPS:PDB   1->66 1dxjA PDBj 6e-15 12.5 %
:RPS:SCOP  1->151 1fugA3  d.130.1.1 * 1e-67 70.7 %
:HMM:SCOP  1->144 1qm4A3 d.130.1.1 * 1.1e-66 70.7 %
:RPS:PFM   2->137 PF02773 * S-AdoMet_synt_C 2e-52 75.8 %
:HMM:PFM   1->137 PF02773 * S-AdoMet_synt_C 1.4e-66 67.7 133/138  
:BLT:SWISS 1->152 METK_CORGL 2e-84 100.0 %
:PROS 23->31|PS00377|ADOMET_SYNTHETASE_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54643.1 GT:GENE BAF54643.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1837334..1837792) GB:FROM 1837334 GB:TO 1837792 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54643.1 LENGTH 152 SQ:AASEQ MGDAGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAMRWVAKNIVAAGLADRAEVQVAYAIGRAKPVGLYVETFDTNKEGLSDEQIQAAVLEVFDLRPAAIIRELDLLRPIYADTAAYGHFGRTDLDLPWEAIDRVDELRAALKLA GT:EXON 1|1-152:0| BL:SWS:NREP 1 BL:SWS:REP 1->152|METK_CORGL|2e-84|100.0|152/407| PROS 23->31|PS00377|ADOMET_SYNTHETASE_2|PDOC00369| BL:PDB:NREP 1 BL:PDB:REP 1->151|1p7lA|1e-53|70.7|147/383| RP:PDB:NREP 1 RP:PDB:REP 1->66|1dxjA|6e-15|12.5|56/242| RP:PFM:NREP 1 RP:PFM:REP 2->137|PF02773|2e-52|75.8|132/138|S-AdoMet_synt_C| HM:PFM:NREP 1 HM:PFM:REP 1->137|PF02773|1.4e-66|67.7|133/138|S-AdoMet_synt_C| GO:PFM:NREP 3 GO:PFM GO:0004478|"GO:methionine adenosyltransferase activity"|PF02773|IPR002133| GO:PFM GO:0005524|"GO:ATP binding"|PF02773|IPR002133| GO:PFM GO:0006730|"GO:one-carbon metabolic process"|PF02773|IPR002133| RP:SCP:NREP 1 RP:SCP:REP 1->151|1fugA3|1e-67|70.7|147/152|d.130.1.1| HM:SCP:REP 1->144|1qm4A3|1.1e-66|70.7|140/144|d.130.1.1|1/1|S-adenosylmethionine synthetase| OP:NHOMO 1311 OP:NHOMOORG 1064 OP:PATTERN ------------------------------------------------------------------11 1221111111111111111-1111111111111111111112211111111111111111111222211111111111111111111111111111---11111111111---------------111111111112112211211111122111111111111111221111111111111111111--1111111111211111111111111111111111111111111111111111111111111111111111111111111111111111112111111121111111111111112111111111111111111121121111111121213311111111111111112111121121111111111111111111-1111111211111111111111-11111111121111111111111111111111111111111111111111111121121111111---1----1---1-1111111111111111111111111111111111111111111111111111111111111111111111111111112111131111111111111221111111111111111111111111111111111121122111111111111111111111111111111111-111221--11111111111112111211-111111211112111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112---11-11111111111111111111111111111111 1111111-429111111111111212-11111111111-11-11111-1111111111111111111111221111221211111111-11111111111111112-12337C55381242222221225F2-22312123212122221211322222-3911221921266411111K211114247154-221115 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 150 STR:RPRED 98.7 SQ:SECSTR cccHHHHHHHHTTTTTTTcccHHHHHccccccHHHHHHHHHHHHHHHHHTcccccccccTTcccccTTcccccEEEEEcTTcccc#ccHHHHHHHHHHHccccHHHHHHHHTccccccGGGGcccccccTcTTcTTTcccHHHHHHHTccc# DISOP:02AL 1-2| PSIPRED cccccccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHccc //