[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54648.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  53/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:106 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->77 PF01765 * RRF 0.00014 23.3 73/165  
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54648.1 GT:GENE BAF54648.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1841149..1841469) GB:FROM 1841149 GB:TO 1841469 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54648.1 LENGTH 106 SQ:AASEQ MALPQLTDEQRKAALAKAAEARKARAELKENLKRGNTNLKEVLDKAESDEIIGKTKVSALLEALPKVGKVKAKEIMDELGIAQTRRLRGLGDRQRRALLERFGFED GT:EXON 1|1-106:0| COIL:NAA 30 COIL:NSEG 1 COIL:REGION 5->34| SEG 11->30|rkaalakaaearkaraelke| SEG 85->99|rrlrglgdrqrrall| HM:PFM:NREP 1 HM:PFM:REP 2->77|PF01765|0.00014|23.3|73/165|RRF| OP:NHOMO 57 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- ---1111111111111111-11111111111111111132-111111-1-----------11--1211111-------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,3-3,105-107| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccc //