[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54657.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54657.1 GT:GENE BAF54657.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1852460..1852924 GB:FROM 1852460 GB:TO 1852924 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54657.1 LENGTH 154 SQ:AASEQ MTTDSTSATTPTPKPIPVTIDRISLIMKEFGIDLAIADEQGTGSQVASANLNGHHVMFAVIGSVLIVRTDRATEMPVSDGNPAWHLACNQVNCFNFAAKAVVVDRTENIVIRAEKDVPIAAGLNDIQLSAMLKNAIDHVLAIQDAVANAGKEIG GT:EXON 1|1-154:0| SEG 2->20|ttdstsattptpkpipvti| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10,153-155| PSIPRED cccccccccccccccEEEEHHHHHHHHHHcccEEEEccccccccEEEEEEcccccEEEEEEccEEEEEEccccccccccccEEEEEEEccccccEEEEEEEEEEcccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //