[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54665.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54665.1 GT:GENE BAF54665.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1859174..1859398) GB:FROM 1859174 GB:TO 1859398 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54665.1 LENGTH 74 SQ:AASEQ MGIDYSSAVDARRAFLGGDLFPHGSAGGRNWWGRYQVGSRFGDSRSSLGNAGSHGGNCGIIVNFCLTGWNFCGC GT:EXON 1|1-74:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,44-52| PSIPRED ccccHHHHHHHHHHHHcccccccccccccccccEEEEHHcccccHHHcccccccccccEEEEEEEEcccccccc //