[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54683.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  182/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.16
:371 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->177 2i7gB PDBj 4e-19 30.5 %
:RPS:PDB   1->324 1brlB PDBj 4e-44 16.0 %
:RPS:SCOP  1->297 1brlB  c.1.16.1 * 6e-43 17.1 %
:HMM:SCOP  1->335 1lucA_ c.1.16.1 * 2.7e-70 31.9 %
:RPS:PFM   30->294 PF00296 * Bac_luciferase 8e-20 34.0 %
:HMM:PFM   1->298 PF00296 * Bac_luciferase 2e-53 29.3 287/307  
:BLT:SWISS 39->250 YWCH_BACSU 1e-08 29.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54683.1 GT:GENE BAF54683.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1881149..1882264 GB:FROM 1881149 GB:TO 1882264 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54683.1 LENGTH 371 SQ:AASEQ MQFGIFTIGDVTVDPTTGKAPTEGERIHAMTQIALKAEEVGLDVFATGEHHNPPFVPSSPTTHLAYIAAKTEKLLLSTSTTLITTNDPVKIAEDYAFLQHLSGGRVDLMMGRGNTGPVYPWFGKDIRQGIPLAIENYHLLRRLWREDVVNWQGKFRTPLQGYTSTPAPLDGVAPFVWHGSIRSTEIAEQAAFYGDGFFHNNIFWNKEHTAQMVNLYRQRFEHYGHGQADQAIVGLGGQVFIGDSEEEAKKTFRPYFDNAPVYGHGPSLEDFSRLTPLTVGTAEQVIERTMEFADWVGDYQRQLFLIDHAGLPLEMVLDQIERLGHDVVPEVRRRMEERRPDHVPSNPPTHQSLKANRNSPHFQINPGQPTE GT:EXON 1|1-371:0| BL:SWS:NREP 1 BL:SWS:REP 39->250|YWCH_BACSU|1e-08|29.3|198/333| SEG 74->85|lllststtlitt| SEG 327->340|vvpevrrrmeerrp| BL:PDB:NREP 1 BL:PDB:REP 2->177|2i7gB|4e-19|30.5|174/338| RP:PDB:NREP 1 RP:PDB:REP 1->324|1brlB|4e-44|16.0|312/319| RP:PFM:NREP 1 RP:PFM:REP 30->294|PF00296|8e-20|34.0|256/296|Bac_luciferase| HM:PFM:NREP 1 HM:PFM:REP 1->298|PF00296|2e-53|29.3|287/307|Bac_luciferase| RP:SCP:NREP 1 RP:SCP:REP 1->297|1brlB|6e-43|17.1|287/319|c.1.16.1| HM:SCP:REP 1->335|1lucA_|2.7e-70|31.9|323/0|c.1.16.1|1/1|Bacterial luciferase-like| OP:NHOMO 251 OP:NHOMOORG 184 OP:PATTERN ------------------------1------------------------------------------- --1-3112222-112-1--------1----------2333-51452111111464112----2-3121122----------------------------1-1---111-1-------------------------------------------------------------------------21-11-----111111111-11111111221-112---21--------341111111111111111--11----11-----111-11-11------111-------11111111111-------------111----11-----------------------------1---------------------1-------------121--------11111111111-1-1111---1--4111121221111-------1111---------------------------------------------------6--------11--1----------------11----------------------------------------------------------------------1---------------------------------------1------------1----1-------------------------------------------------------11------------------------------------------------------------------------------------------2-1--1-11--------------------------------------------------------------1-------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 87.3 SQ:SECSTR cEEEEEEcccccccccHHHHHHHccccTTHHHHHHHHHTTTccEEEEccccccccccccHHHHHHHHHHHccccEEEEEEEEcTTccHHHHHHHHHHHHHHHTccEEEEEEccccHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHcEEccccccccEcccEEcccccccTTccEEEEEEHccHHHHHHHHHTTccEEEcTcTccHHHHHHHHHHHHHHHHHHccccTTccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHcTTccHHHHHHHHcEEEcHHHHHHHHHHHHHHHcccccEEEEEcTTcccHHHHHHHHHHHH############################################### DISOP:02AL 335-347,363-372| PSIPRED cccccEEcccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEHHcccccccccHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccccccEEEEccccHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEEcccHHHHHHHHHHHHHccHHccccccHHHHHHccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccEEEccccccc //