[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54692.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:114 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->72 PF10099 * RskA 0.00017 26.2 42/175  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54692.1 GT:GENE BAF54692.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1890628..1890972 GB:FROM 1890628 GB:TO 1890972 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54692.1 LENGTH 114 SQ:AASEQ MHNGESAHKVTFVFEYLNLRGLAMKLFSRTSLVALGTAAAMAATSISVPAQAEEVAPAQVVYVADTVEEETGSSNGSSDIDSDTILDYVVVITGIIGVLSAGLTFATAFQRSLQ GT:EXON 1|1-114:0| TM:NTM 2 TM:REGION 29->51| TM:REGION 87->109| SEG 32->64|lvalgtaaamaatsisvpaqaeevapaqvvyva| SEG 71->85|tgssngssdidsdti| HM:PFM:NREP 1 HM:PFM:REP 31->72|PF10099|0.00017|26.2|42/175|RskA| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-8,68-81,114-115| PSIPRED cccccccEEEEEEEEEEcHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccEEEEEEEEccHHHHccccccccccccHHEEEHHEEEHHHHHHHccHHHHHHHHHHcc //