[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54699.1
DDBJ      :             hypothetical protein
Swiss-Prot:RUVB_CORGB   RecName: Full=Holliday junction ATP-dependent DNA helicase ruvB;         EC=3.6.1.-;

Homologs  Archaea  2/68 : Bacteria  888/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.37.1
:363 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   44->356 1ixsB PDBj 1e-81 50.2 %
:RPS:PDB   54->333 2dhrD PDBj 6e-21 20.1 %
:RPS:SCOP  46->281 1hqcA2  c.37.1.20 * 4e-30 49.6 %
:RPS:SCOP  296->356 1hqcA1  a.4.5.11 * 4e-11 47.5 %
:HMM:SCOP  44->281 1in4A2 c.37.1.20 * 4e-49 29.4 %
:HMM:SCOP  282->357 1hqcA1 a.4.5.11 * 6.1e-28 56.6 %
:RPS:PFM   38->262 PF05496 * RuvB_N 4e-78 64.0 %
:RPS:PFM   279->353 PF05491 * RuvB_C 5e-11 41.3 %
:HMM:PFM   31->261 PF05496 * RuvB_N 3.4e-111 63.6 231/234  
:HMM:PFM   279->353 PF05491 * RuvB_C 7.9e-31 58.7 75/76  
:BLT:SWISS 1->363 RUVB_CORGB e-179 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54699.1 GT:GENE BAF54699.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1899823..1900914) GB:FROM 1899823 GB:TO 1900914 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54699.1 LENGTH 363 SQ:AASEQ MSDVERTEFEIPGGIPPRRNGGQGRAADTNVDANLKPDEYDAEVTLRPKSLTEFIGQPKVRDQLSLVLTGAKNRGVVPDHVLLSGPPGLGKTTMAMIIAQELGTSLRMTSGPALERAGDLAAMLSNLMEGDVLFIDEIHRIARPAEEMLYMAMEDFRIDVIVGKGPGATSIPLEIPPFTLVGATTRSGMLTGPLRDRFGFTAQMEFYDVPDLTKVVKRTAKILDVGIDNDAAVEIASRSRGTPRIANRLLRRVRDFAEVHADGHITMGAANAALIVFDVDEVGLDRLDRAVLDALIRGHGGGPVGVNTLAVAVGEEPGTVEEVCEPYLVRAGMIARTGRGRVATAAAWRHLGLEPPEGTIGDY GT:EXON 1|1-363:0| SW:ID RUVB_CORGB SW:DE RecName: Full=Holliday junction ATP-dependent DNA helicase ruvB; EC=3.6.1.-; SW:GN Name=ruvB; OrderedLocusNames=cgR_1705; SW:KW ATP-binding; Complete proteome; DNA damage; DNA recombination;DNA repair; Helicase; Hydrolase; Nucleotide-binding; SOS response. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->363|RUVB_CORGB|e-179|100.0|363/363| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0004386|"GO:helicase activity"|Helicase| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0009432|"GO:SOS response"|SOS response| SEG 12->25|pggipprrnggqgr| SEG 284->295|ldrldravldal| SEG 335->349|artgrgrvataaawr| BL:PDB:NREP 1 BL:PDB:REP 44->356|1ixsB|1e-81|50.2|313/315| RP:PDB:NREP 1 RP:PDB:REP 54->333|2dhrD|6e-21|20.1|269/445| RP:PFM:NREP 2 RP:PFM:REP 38->262|PF05496|4e-78|64.0|225/232|RuvB_N| RP:PFM:REP 279->353|PF05491|5e-11|41.3|75/76|RuvB_C| HM:PFM:NREP 2 HM:PFM:REP 31->261|PF05496|3.4e-111|63.6|231/234|RuvB_N| HM:PFM:REP 279->353|PF05491|7.9e-31|58.7|75/76|RuvB_C| GO:PFM:NREP 7 GO:PFM GO:0006281|"GO:DNA repair"|PF05496|IPR008824| GO:PFM GO:0006310|"GO:DNA recombination"|PF05496|IPR008824| GO:PFM GO:0009378|"GO:four-way junction helicase activity"|PF05496|IPR008824| GO:PFM GO:0003677|"GO:DNA binding"|PF05491|IPR008823| GO:PFM GO:0006281|"GO:DNA repair"|PF05491|IPR008823| GO:PFM GO:0006310|"GO:DNA recombination"|PF05491|IPR008823| GO:PFM GO:0009378|"GO:four-way junction helicase activity"|PF05491|IPR008823| RP:SCP:NREP 2 RP:SCP:REP 46->281|1hqcA2|4e-30|49.6|236/238|c.37.1.20| RP:SCP:REP 296->356|1hqcA1|4e-11|47.5|61/76|a.4.5.11| HM:SCP:REP 44->281|1in4A2|4e-49|29.4|238/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 282->357|1hqcA1|6.1e-28|56.6|76/76|a.4.5.11|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 960 OP:NHOMOORG 901 OP:PATTERN -------------------------------------------1---1-------------------- 1111111111122111111-122211111111211122111111111111111112111111111221111211122211111--111111122221--11111111112111111111111111111111111111111112111111111121111111111111111121111111111111122111111111111111111111111111111211-1111111111111111111111111111111121111112121111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111112111111111112111111111111111111111111111111111-112121121111111111111111111111122111112111111112221111111111111111111111111111111111-11211111111111111111111111111111111111111111111111111111121111111111111111111111-1211121111111111111111111112111211111211121111111122111111111111111111111111111111111-11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111212111111111-11111111111111111111111111111111111111111121111111111112111111111111111-12111111111111111111---11-11-11111111111111111111111111111 ------------11------------------------------------------------1-1----2----1--------11-----1---1----------------------------------------------------------------------1--------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-40,356-364| PSIPRED cccHHHcccccccccccccccccccccccccccccccccHHHHHHHccccHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccEEEEcccHHccHHHHHHHHHHcccccEEEEEcHHHccHHHHHHHHHHHHccEEEEEEEccccccccccccccEEEEEEcccHHHccHHHHccccEEEEEccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccHHHccc //