[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54715.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  277/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.141.1
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->138 1to6A PDBj 3e-15 37.1 %
:RPS:PDB   33->128 3ecsC PDBj 8e-08 19.4 %
:RPS:SCOP  33->139 1to6A  c.141.1.1 * 2e-21 36.8 %
:HMM:SCOP  11->142 1to6A_ c.141.1.1 * 2.9e-33 43.5 %
:RPS:PFM   33->140 PF02595 * Gly_kinase 2e-18 40.7 %
:HMM:PFM   9->140 PF02595 * Gly_kinase 5.6e-32 34.8 132/378  
:BLT:SWISS 33->139 GLXK_BACSU 3e-15 33.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54715.1 GT:GENE BAF54715.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1915206..1915640 GB:FROM 1915206 GB:TO 1915640 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54715.1 LENGTH 144 SQ:AASEQ MFEQALGLTTLAQTAGAGAAGGLGFMAMALLSAEMRSGVDMILNETGGEKMLAQADLVITGEGRIDAQTLSGKAPTGIAKRARAKDIPVLAVCGQSLLDPAISNELFEDIYSLTDFESDINECIRNPLPILEGIGFNIAKHHLS GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 33->139|GLXK_BACSU|3e-15|33.6|107/382| SEG 4->31|qalglttlaqtagagaagglgfmamall| BL:PDB:NREP 1 BL:PDB:REP 33->138|1to6A|3e-15|37.1|105/371| RP:PDB:NREP 1 RP:PDB:REP 33->128|3ecsC|8e-08|19.4|93/287| RP:PFM:NREP 1 RP:PFM:REP 33->140|PF02595|2e-18|40.7|108/376|Gly_kinase| HM:PFM:NREP 1 HM:PFM:REP 9->140|PF02595|5.6e-32|34.8|132/378|Gly_kinase| GO:PFM:NREP 2 GO:PFM GO:0008887|"GO:glycerate kinase activity"|PF02595|IPR004381| GO:PFM GO:0031388|"GO:organic acid phosphorylation"|PF02595|IPR004381| RP:SCP:NREP 1 RP:SCP:REP 33->139|1to6A|2e-21|36.8|106/371|c.141.1.1| HM:SCP:REP 11->142|1to6A_|2.9e-33|43.5|131/371|c.141.1.1|1/1|Glycerate kinase I| OP:NHOMO 301 OP:NHOMOORG 278 OP:PATTERN -------------------------------------------------------------------- ---11---111--1-----------------------121------2-----212--1-----1112----1---------1--------11---------------1-1-----------------------------------------------------------------------------------1--1-1111111111111-111111111-1-------111-1111111111111111111-1-------1----------------111----111111111111111---111111111111111111-1-----------------------11-1--1--11----11----111---------------------------------------------------------------------------------------11-----------------------------------------1-1-------------------------------------------------------111111--------------1---------1---------1----11------------------------1-1-1-----1-1111--111111111111--------------1111111111111111-11111111111111111112131111121122122222222221---------111111111111---------------11-111-11-111--111------11111-----11111-1-1--11-----1----11111111111212--1-1--111-------1--------------1---------------------------------------- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 106 STR:RPRED 73.6 SQ:SECSTR ################################HHHTTTccEEEEcGGGHHHHGGccEEEEcccEEcTTcEEEETTHHHHHHHHHTTccEEEEccGGGccccccccGGGGccHHHHcccccccccccccHHHHHHHHHH###### DISOP:02AL 1-6| PSIPRED cccccccHHHHHHcccccccccHHHHHHHHHccEEEEHHHHHHHHHcHHHHHccccEEEEcccccccccccccHHHHHHHHHHHHcccEEEEEEEccccHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcc //