[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54733.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  94/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:410 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   221->393 1woqA PDBj 2e-49 51.7 %
:RPS:PDB   167->402 2aa4A PDBj 2e-18 20.0 %
:RPS:SCOP  167->283 1woqA1  c.55.1.10 * 3e-13 41.4 %
:RPS:SCOP  286->404 1woqA2  c.55.1.10 * 7e-35 53.8 %
:HMM:SCOP  161->412 1sz2A1 c.55.1.7 * 1.6e-30 33.2 %
:RPS:PFM   167->320 PF00480 * ROK 6e-11 34.0 %
:HMM:PFM   167->318 PF00480 * ROK 1.2e-16 30.9 149/179  
:BLT:SWISS 180->403 PPGK_MYCTU 7e-59 48.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54733.1 GT:GENE BAF54733.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1929271..1930503 GB:FROM 1929271 GB:TO 1930503 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54733.1 LENGTH 410 SQ:AASEQ MARGGVQHPGDHIDHSTCYDLAVDRRSDRDGVLGQAIKEVDGAVNGVDDPGNSAYRRRPRPFLAYQPVFRPKFLQPIGDKIFSQSIYYRHRIDCRTFGVGVVPQIGEFSTFIPDTCSGKRGSFRGDGTQLIKRLLFHKTIIVVFLENCLPKAEVICTLGRMTETGFGIDIGGSGIKGARVNLKTGEFIDERIKIATPKPATPEAVAEVVAEIISQAEWEGPVGITLPSVVRGQIALSAANIDKSWIGTDVHELFDRHLNGREITVLNDADAAGIAEATFGNAAAREGAVILLTLGTGIGSAFLVDGQLFPNTELGHMIVDGEEAEHLAAAAVKENEDLSWKKWAKRLNKVLSEYEKLFSPSVFIIGGGISRKHEKWLPLLELDTDIVPAELRNRAGIVGAAMAVNQHLTP GT:EXON 1|1-410:0| BL:SWS:NREP 1 BL:SWS:REP 180->403|PPGK_MYCTU|7e-59|48.7|224/265| SEG 195->211|atpkpatpeavaevvae| BL:PDB:NREP 1 BL:PDB:REP 221->393|1woqA|2e-49|51.7|172/253| RP:PDB:NREP 1 RP:PDB:REP 167->402|2aa4A|2e-18|20.0|230/289| RP:PFM:NREP 1 RP:PFM:REP 167->320|PF00480|6e-11|34.0|150/181|ROK| HM:PFM:NREP 1 HM:PFM:REP 167->318|PF00480|1.2e-16|30.9|149/179|ROK| RP:SCP:NREP 2 RP:SCP:REP 167->283|1woqA1|3e-13|41.4|116/129|c.55.1.10| RP:SCP:REP 286->404|1woqA2|7e-35|53.8|119/124|c.55.1.10| HM:SCP:REP 161->412|1sz2A1|1.6e-30|33.2|241/0|c.55.1.7|1/1|Actin-like ATPase domain| OP:NHOMO 99 OP:NHOMOORG 95 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111111111111111-11111111221121111----1111111111111111----1--------------------111---1----------------------------------2-1-------------------1111-------------111--------------1----------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1-------------------------------------------------1------11--------1-----------------------------------------------------------------------1-----------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 264 STR:RPRED 64.4 SQ:SECSTR ##################################################################################################################################################ccEEcccccccccccccEEEEEEEcccEEEEEEEcTTEccEEEEEEEEEccccccHHHHHHHHHHHHTTTGGGccEEEEEEEEETTEEEcccGGGGGGGTTccHHHHHHHHHccccEEEEEHHHHHHHHHHHTcTTcTTcccEEEEEEcccEEEEEEETTEEEccTcGGGccccTccHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEHHHHTGcTTHHHHHHGccEEEEccccccHHHHHHHHHHHHHHHH DISOP:02AL 1-8| PSIPRED cccccccccccccccccEEEEEEccccccccHHHHHHHHHHHccccccccccHHHHccccccccccccccHHHHHHHHHHHHHccEEEEEEEccEEEcccccccccccccccccccccccccccccHHHHHHHHHHccEEEEEEEccccccccEEEEEcccccEEEEEEEcccEEEEEEEEccccEEEEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEEccccEEccEEEEEcccccccccccHHHHHHHHHccccEEEEEcHHHHHHHHHHHccccccccEEEEEEEccccEEEEEEccEEEcccEEEEEEEcccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHccc //