[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54737.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->107 PF01708 * Gemini_mov 0.00012 34.6 52/92  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54737.1 GT:GENE BAF54737.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1934686..1935225) GB:FROM 1934686 GB:TO 1935225 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54737.1 LENGTH 179 SQ:AASEQ MTTPNYPYGEPNNNGGNSNDPFNANQGEPYGAPYGESFGPSSGAQQSGYQDPYGSGYTGGFENSPLNAPKNTAAAWALGLGIASIVTLVTVFGAFLSPFLALAGVIVAIIALVKAKNFVPANRRKGFAITGLILSILTLILLAIGVILILVVFSSSGLSECATLTDPAAQEQCIQELFA GT:EXON 1|1-179:0| TM:NTM 3 TM:REGION 72->94| TM:REGION 98->119| TM:REGION 131->153| SEG 4->25|pnypygepnnnggnsndpfnan| SEG 100->116|lalagvivaiialvkak| SEG 128->152|aitglilsiltlillaigvililvv| HM:PFM:NREP 1 HM:PFM:REP 45->107|PF01708|0.00012|34.6|52/92|Gemini_mov| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,15-24,45-52| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHc //