[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54740.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:218 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   87->164 PF11298 * DUF3099 8e-16 53.4 %
:HMM:PFM   87->162 PF11298 * DUF3099 6.4e-28 47.2 72/73  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54740.1 GT:GENE BAF54740.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1937205..1937861 GB:FROM 1937205 GB:TO 1937861 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54740.1 LENGTH 218 SQ:AASEQ MVLLHVVEELRGVVACRVIFPDIGTFNGLCCCSHLTHHAPDSSVVTKRTTLFGMNQRKDRPDGTSDESEHSPKKRLRKLFHRNEVLLITDKKRTPMQDMRHRRRIYNVIQALRIPLLILAGVSWVMWHAWVLAIIIFFISIPLPWVAVVIANGHGSPRDPREKNVYKPGLVREMNERAQLEAQQAQQLENRSTEVDIRRTFDGIIIDAQEEKDTNDND GT:EXON 1|1-218:0| TM:NTM 3 TM:REGION 8->30| TM:REGION 106->128| TM:REGION 132->153| SEG 175->191|neraqleaqqaqqlenr| RP:PFM:NREP 1 RP:PFM:REP 87->164|PF11298|8e-16|53.4|73/75|DUF3099| HM:PFM:NREP 1 HM:PFM:REP 87->162|PF11298|6.4e-28|47.2|72/73|DUF3099| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- -----11-111-11-1111-11--111111111----1----------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 55-76,95-97,209-219| PSIPRED cHHHHHHHHHHHHEEEEEEcccccccccHHHHHHHHHccccccEEEEHHHHHcccccccccccccHHHHccHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHEEEEcEEEEEcHHHccccccc //