[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54754.1
DDBJ      :             hypothetical protein
Swiss-Prot:LEXA_CORGB   RecName: Full=LexA repressor;         EC=3.4.21.88;

Homologs  Archaea  0/68 : Bacteria  620/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.87.1
:253 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->251 1jhhA PDBj 5e-24 35.6 %
:RPS:PDB   32->96 1dpuA PDBj 4e-08 19.0 %
:RPS:PDB   151->253 1ay9A PDBj 1e-22 29.4 %
:RPS:SCOP  50->97 2pg4A1  a.4.5.48 * 7e-12 22.9 %
:RPS:SCOP  134->252 1jhcA  b.87.1.1 * 4e-24 37.0 %
:HMM:SCOP  30->100 1jhfA1 a.4.5.2 * 8.4e-20 47.9 %
:HMM:SCOP  131->252 1jhfA2 b.87.1.1 * 1e-32 38.5 %
:RPS:PFM   32->93 PF01726 * LexA_DNA_bind 4e-13 56.5 %
:HMM:PFM   31->93 PF01726 * LexA_DNA_bind 4.5e-27 54.0 63/65  
:HMM:PFM   172->235 PF00717 * Peptidase_S24 5.3e-13 28.6 63/70  
:BLT:SWISS 1->253 LEXA_CORGB e-133 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54754.1 GT:GENE BAF54754.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1955829..1956590 GB:FROM 1955829 GB:TO 1956590 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54754.1 LENGTH 253 SQ:AASEQ MAIEKKPAGARGSRGSRTVKTLPNGKPDPASLSDRQRRILEVIRDAVVLRGYPPSIREIGDAAGLQSTSSVAYQLKELEKKGFLRRDPNKPRAVDVRHLPETESRSSKAATQAKSKAPQAGAHDPELAGQTSFVPVVGKIAAGSPITAEQNIEEYYPLPAEIVGDGDLFMLQVVGESMRDAGILTGDWVVVRSQPVAEQGEFVAAMIDGEATVKEFHKDSSGIWLLPHNDTFAPIPAENAEIMGKVVSVMRKL GT:EXON 1|1-253:0| SW:ID LEXA_CORGB SW:DE RecName: Full=LexA repressor; EC=3.4.21.88; SW:GN Name=lexA; OrderedLocusNames=cgR_1760; SW:KW Autocatalytic cleavage; Complete proteome; DNA damage; DNA repair;DNA replication; DNA-binding; Hydrolase; Repressor; SOS response;Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->253|LEXA_CORGB|e-133|100.0|253/253| GO:SWS:NREP 8 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0006260|"GO:DNA replication"|DNA replication| GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0009432|"GO:SOS response"|SOS response| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| SEG 106->120|sskaatqakskapqa| BL:PDB:NREP 1 BL:PDB:REP 31->251|1jhhA|5e-24|35.6|191/197| RP:PDB:NREP 2 RP:PDB:REP 32->96|1dpuA|4e-08|19.0|63/69| RP:PDB:REP 151->253|1ay9A|1e-22|29.4|102/108| RP:PFM:NREP 1 RP:PFM:REP 32->93|PF01726|4e-13|56.5|62/64|LexA_DNA_bind| HM:PFM:NREP 2 HM:PFM:REP 31->93|PF01726|4.5e-27|54.0|63/65|LexA_DNA_bind| HM:PFM:REP 172->235|PF00717|5.3e-13|28.6|63/70|Peptidase_S24| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF01726|IPR006199| GO:PFM GO:0006508|"GO:proteolysis"|PF01726|IPR006199| RP:SCP:NREP 2 RP:SCP:REP 50->97|2pg4A1|7e-12|22.9|48/92|a.4.5.48| RP:SCP:REP 134->252|1jhcA|4e-24|37.0|119/130|b.87.1.1| HM:SCP:REP 30->100|1jhfA1|8.4e-20|47.9|71/0|a.4.5.2|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 131->252|1jhfA2|1e-32|38.5|122/126|b.87.1.1|1/1|LexA/Signal peptidase| OP:NHOMO 697 OP:NHOMOORG 622 OP:PATTERN -------------------------------------------------------------------- 111-111111111111111-11111111111111112222111111111111111111--111-212111111111111111---1-1----------------------------------------1-111--111111114111-11--1-----1-111---1-----1-11-11-1--1-1--11-12111111211112212121111111111111111111111211111111111111-1111111-11111111111111111111-----------------------------------------------31122222222212121221111111-1112221121211211---11--1-11111-1111111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------111111111111111111111111111111111111111111111111111111111111111-----------11111-1--13-------2-211211311111112-------------------------21111121111111111111111111111111----112------12111121111111111-1111111111111111111121111111111111111111111111111111-111111111111---------211-11121111111111111111----------1111112222122221222---------21111111111111111222222221111--31111111------------------------------------1111111111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 246 STR:RPRED 97.2 SQ:SECSTR #######ccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHTTTTTcTEccHHHHHHHTccHHHHHHHTTTTccccHHEEEcTHHHHTTTTTTccGGGTcHHHHHHHHHHHHHHHcccccccccccccccccccccTTTTccccccccccccHHHHHcccGGEEEEEccccTTGGGTccTTcEEEEEccccccTTcEEEEEETTEEEEEEEEccccccEEEcccTTcccETTccEEEEEEEEEEEccc DISOP:02AL 1-36,106-122| PSIPRED cccccccccccHHHHHHHccccccccccHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHcccEEccccccccccccccHHHHccccccccccccccccccccccccccccEEccEEEEEEccccccccccccEEEEccHHHccccccEEEEEEcccccccccccccEEEEEcccccccccEEEEEEccEEEEEEEEEEccEEEEEEccccccccccccEEEEEEEEEEEEcc //