[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54755.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  541/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.5c.124.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->55 1bibA PDBj 5e-11 13.7 %
:RPS:PDB   30->256 3dlxB PDBj 7e-26 8.3 %
:RPS:SCOP  3->57 1lvaA4  a.4.5.35 * 1e-11 20.0 %
:RPS:SCOP  98->256 1t5oA  c.124.1.5 * 4e-16 11.1 %
:HMM:SCOP  2->81 1stzA1 a.4.5.51 * 2.3e-13 36.2 %
:HMM:SCOP  74->241 1lk5A1 c.124.1.4 * 7.5e-25 27.2 %
:RPS:PFM   6->57 PF08220 * HTH_DeoR 4e-09 48.1 %
:RPS:PFM   98->237 PF00455 * DeoR 2e-25 45.3 %
:HMM:PFM   78->237 PF00455 * DeoR 2.2e-38 34.0 156/157  
:HMM:PFM   6->61 PF08220 * HTH_DeoR 2.7e-17 42.9 56/57  
:BLT:SWISS 18->257 AGAR_ECOLI 1e-26 30.5 %
:PROS 68->96|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54755.1 GT:GENE BAF54755.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1956894..1957673 GB:FROM 1956894 GB:TO 1957673 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54755.1 LENGTH 259 SQ:AASEQ MYAEERRRQIASLTAVEGRVNVTELAGRFDVTAETIRRDLAVLDREGIVHRVHGGAVATQSFQTTELSLDTRFRSASSAKYSIAKAAMQFLPAEHGGLFLDAGTTVTALADLISEHPSAKQWSIVTNCLPIALNLANAGLDDVQLLGGSVRAITQAVVGDTALRTLALMRADVVFIGTNALTLDHGLSTADSQEAAMKSAMITNAHKVVVLCDSTKMGTDYLVSFGAISDIDVVVTDAGAPASFVEQLRERDVEVVIAE GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 18->257|AGAR_ECOLI|1e-26|30.5|236/269| PROS 68->96|PS00061|ADH_SHORT|PDOC00060| SEG 75->87|sassakysiakaa| RP:PDB:NREP 2 RP:PDB:REP 5->55|1bibA|5e-11|13.7|51/294| RP:PDB:REP 30->256|3dlxB|7e-26|8.3|218/465| RP:PFM:NREP 2 RP:PFM:REP 6->57|PF08220|4e-09|48.1|52/56|HTH_DeoR| RP:PFM:REP 98->237|PF00455|2e-25|45.3|137/157|DeoR| HM:PFM:NREP 2 HM:PFM:REP 78->237|PF00455|2.2e-38|34.0|156/157|DeoR| HM:PFM:REP 6->61|PF08220|2.7e-17|42.9|56/57|HTH_DeoR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08220|IPR001034| GO:PFM GO:0005622|"GO:intracellular"|PF08220|IPR001034| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF08220|IPR001034| RP:SCP:NREP 2 RP:SCP:REP 3->57|1lvaA4|1e-11|20.0|55/60|a.4.5.35| RP:SCP:REP 98->256|1t5oA|4e-16|11.1|153/340|c.124.1.5| HM:SCP:REP 2->81|1stzA1|2.3e-13|36.2|80/87|a.4.5.51|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 74->241|1lk5A1|7.5e-25|27.2|147/150|c.124.1.4|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 1813 OP:NHOMOORG 546 OP:PATTERN ------------------------2--1---------------------------------------- 23--8223445111-------3---4------322212231--1611-12225351-4--2135549646311111112---1--------1--------12--13-6-A--------------------------22211----------------------------1-------------11---21-31422222223232222275442423211113236666665A2222222222222224322341-1591-22155--771311--23233433334333333333333344444444444444322213335411772212232424-3--234222-2-2121----1--1--42224221--12--------1-112---1211144444444443---1--1-217--9554453987532----2124134221111111113112---3-------------------------------1---111112224332222244772222124362232--1211-1111-1324-------311111111----1---2---11--1---1-------11-----1-----------------------------4372--11-2221111--11221111-111-------------6476543888A8AAA99-8A898989898A8788985AAC4533297A9A9A998998999877699872-644444344444---------------116444736223225774----------2122121534222222455----------333744444332561111111----------3---------------------1---2-1------21-------31--12111-11 -------------2------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 100.0 SQ:SECSTR ccccEEEEEcTTccEEEEEEETTTTEEEEEEEEEEEcEEEcTTcccGGGccccGGGccEEEEcccccccccccccccHHHHHHHHHHGGGcccTTEEEEEcTTHHHHHGGGcEEGccTTccEEEEETTTEEEEccccTTcccTTcccccEEEEEEEccHHHHHHHHHTTcccEEEEcccEEETTccEEccccTccTTHHHHTccTTcEEEEGGEEcEEccccccccccccccEEEcccEEEEEEEEEETTTEEEEEHHH DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHcccEEHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHcccccEEEEEccEEEccccEEEcHHHHHHHHcccccEEEEEccccccccccccccHHHHHHHHHHHHHcccEEEEEccccccccEEEEEEcHHHccEEEccccccHHHHHHHHHcccEEEEEc //