[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54763.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  489/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
:429 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   39->381 PF00860 * Xan_ur_permease 2e-10 27.6 %
:HMM:PFM   35->390 PF00860 * Xan_ur_permease 2.3e-84 40.6 350/389  
:BLT:SWISS 23->387 RUTG_ECOLI 2e-67 44.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54763.1 GT:GENE BAF54763.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1966388..1967677) GB:FROM 1966388 GB:TO 1967677 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54763.1 LENGTH 429 SQ:AASEQ MLVTSTWGWTVHGDGKKIEPGAVVAPKERLSWGRTIGIGMQHVIAMFGATLLVPTLTGFPVNTTLLFSGLGTILFLLITRNRLPSYLGSSFAFIAPLTATQVHGIGVQIGGILVAGLVLVAIGFVVKAAGKRVIDAVMPPAVTGAIVALIGLNLAPTAAGNFSSQPLVATVTLFAILIATVAGRGMIARLGILIGVVIGWVFAAITGNLSEGAADTIREAAWFGLPQFHKPEFQLSAILVTLPVIIVLIAENVGHVKAVSEMTGEDLDDLAGDALIADGFGTTLAGAFGGSGTTTYAENIGVMAATRVYSTAAYWVAACTAIALAFIPKFGALIFTIPAGVLGGACLVLYGLIGMLGIRIWQDNKVNFNNPVNLTMAAVALVAGIGNLTLTVFGVTLEGIAWGSVGIIVLYPIMKRLYLSIGEGKNAKF GT:EXON 1|1-429:0| BL:SWS:NREP 1 BL:SWS:REP 23->387|RUTG_ECOLI|2e-67|44.4|365/442| TM:NTM 10 TM:REGION 34->56| TM:REGION 71->93| TM:REGION 106->128| TM:REGION 135->157| TM:REGION 163->185| TM:REGION 187->209| TM:REGION 235->257| TM:REGION 313->335| TM:REGION 340->361| TM:REGION 382->404| SEG 104->126|gigvqiggilvaglvlvaigfvv| SEG 238->249|ilvtlpviivli| SEG 264->295|gedlddlagdaliadgfgttlagafggsgttt| RP:PFM:NREP 1 RP:PFM:REP 39->381|PF00860|2e-10|27.6|337/381|Xan_ur_permease| HM:PFM:NREP 1 HM:PFM:REP 35->390|PF00860|2.3e-84|40.6|350/389|Xan_ur_permease| GO:PFM:NREP 4 GO:PFM GO:0005215|"GO:transporter activity"|PF00860|IPR006043| GO:PFM GO:0006810|"GO:transport"|PF00860|IPR006043| GO:PFM GO:0016020|"GO:membrane"|PF00860|IPR006043| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00860|IPR006043| OP:NHOMO 641 OP:NHOMOORG 507 OP:PATTERN --------------------------------1-----11-11----1------1---111------- ----1111111-11-------1---2------1111-432----11211111111111----1111211111111111-111------111---11--------------------------------------------------1--------------1----------------------1111---1111111111111111111111111111111111222222111111111111111111111111212221212221122223112222111211121122222222222222222222222212112111121332211111111121211133311-211111-11-1--11111111-1---------------1------------11-111111---1--1-------11----------------2----------------------------------------------------------111112221221111122111121121111111--11---11111111--------111111111--------1-2111111111-1-11-1---1111-----111-----------------------1-1-1-1---11111111111111111111-------------12111212222212322-2222222222212222221222111-1111111111111111121122222--2---1----111--------------1111111-111111111111112112111--11111111111111-11----------11111111111111--------------------------------1------1--------------------1--1111111--- ----22----------------------------------1--------------------------------------------------------------221--------------------------------------------------------------------2--1--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,11-23,425-430| PSIPRED cccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccc //