[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54772.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:223 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54772.1 GT:GENE BAF54772.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(1976193..1976864) GB:FROM 1976193 GB:TO 1976864 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54772.1 LENGTH 223 SQ:AASEQ MNNNVSDQKLSGKELAALEKQAAKTLELGDKKWYLIAGVVLFAIALVLPHIRGVMGWQVLTLSNVAEDAGITLGEYGFYWLGTIGVFLLSLGTVVFKRTWMAWISWIFSCVTLVFAVFAIWMRQTTTSTQVNFVNIGMMLAVIAAILAVWGLSSVILARSDRQMEIAEMRAENPDLDGVAATQRALLEQQQSNPEDNPLLVDDRRARIARRREREQDTQGEQA GT:EXON 1|1-223:0| TM:NTM 4 TM:REGION 36->58| TM:REGION 75->96| TM:REGION 100->121| TM:REGION 133->155| SEG 13->28|kelaalekqaaktlel| SEG 204->215|rrariarrrere| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ------111111-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-13,164-166,184-199,203-224| PSIPRED ccccccHHHccHHHHHHHHHHHHHHEEEccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHcccEEHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHcccc //