[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54789.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   24->81 2glfA PDBj 4e-04 31.0 %
:RPS:SCOP  3->91 1mwqA  d.58.4.7 * 3e-15 24.4 %
:HMM:SCOP  1->92 1mwqA_ d.58.4.7 * 6.3e-18 34.8 %
:RPS:PFM   4->86 PF03795 * YCII 2e-06 36.2 %
:HMM:PFM   3->89 PF03795 * YCII 2e-09 26.2 84/95  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54789.1 GT:GENE BAF54789.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 1990392..1990679 GB:FROM 1990392 GB:TO 1990679 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54789.1 LENGTH 95 SQ:AASEQ MTYFAVLYTYNPDSEKVAEVRTVHREFIANLHAEGKIVGSGPFVDGDGGALIVIKLEEGSNLVDAETLMNNDPFHVENVLDNRVIRSWNPVTKDF GT:EXON 1|1-95:0| BL:PDB:NREP 1 BL:PDB:REP 24->81|2glfA|4e-04|31.0|58/437| RP:PFM:NREP 1 RP:PFM:REP 4->86|PF03795|2e-06|36.2|80/94|YCII| HM:PFM:NREP 1 HM:PFM:REP 3->89|PF03795|2e-09|26.2|84/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 3->91|1mwqA|3e-15|24.4|86/100|d.58.4.7| HM:SCP:REP 1->92|1mwqA_|6.3e-18|34.8|89/100|d.58.4.7|1/1|Dimeric alpha+beta barrel| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----1111112--------------------------1--------------111--1---------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 61.1 SQ:SECSTR #######################cHHHHHHHHHTTEEcccccTTccccccTHHHHHTTTccEEEEcEEccTcccEEEEHHH############## PSIPRED ccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccEEEEEEccccccccEEEEEEEEccccHHHHHHHHHccccHHHccEEEEEEEcHHHHHccc //