[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF54835.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  908/915 : Eukaryota  196/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:230 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   3->224 1l2tB PDBj 8e-31 33.8 %
:RPS:PDB   1->224 3dmdC PDBj 7e-34 11.7 %
:RPS:SCOP  9->222 1sgwA  c.37.1.12 * 2e-32 19.8 %
:HMM:SCOP  5->224 1ii8.1 c.37.1.12 * 1.3e-55 37.9 %
:RPS:PFM   34->52 PF03205 * MobB 9e-04 78.9 %
:RPS:PFM   46->175 PF00005 * ABC_tran 1e-14 38.2 %
:HMM:PFM   46->175 PF00005 * ABC_tran 8.9e-23 38.8 116/118  
:HMM:PFM   13->55 PF03308 * ArgK 2.4e-07 34.9 43/267  
:BLT:SWISS 3->225 MACB_VIBPA 4e-39 41.7 %
:PROS 147->161|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF54835.1 GT:GENE BAF54835.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2045075..2045767 GB:FROM 2045075 GB:TO 2045767 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF54835.1 LENGTH 230 SQ:AASEQ MTLHVSNLNLTVADGSTSRTLLNNITFDVQPGEVVGITGPSGSGKSTLLAVLGCLQSADSGTATLGDIDLLNPHNRAALRRNHLGIVFQQPNLLPSLTVLDQLLLIPRLGRILPPSRSARTQHKDKALSLLNSIGLGDLAKRKVSELSGGQQARVNLVRALMNSPKLLLVDEPTAALDQHSASEVTELIVSMAHQYNAPTLFVSHDMDAVNTLDRSIELVDGHLLTPHTL GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 3->225|MACB_VIBPA|4e-39|41.7|216/654| PROS 147->161|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 103->118|llliprlgrilppsrs| BL:PDB:NREP 1 BL:PDB:REP 3->224|1l2tB|8e-31|33.8|219/232| RP:PDB:NREP 1 RP:PDB:REP 1->224|3dmdC|7e-34|11.7|197/318| RP:PFM:NREP 2 RP:PFM:REP 34->52|PF03205|9e-04|78.9|19/139|MobB| RP:PFM:REP 46->175|PF00005|1e-14|38.2|123/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 46->175|PF00005|8.9e-23|38.8|116/118|ABC_tran| HM:PFM:REP 13->55|PF03308|2.4e-07|34.9|43/267|ArgK| GO:PFM:NREP 4 GO:PFM GO:0005525|"GO:GTP binding"|PF03205|IPR004435| GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF03205|IPR004435| GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 9->222|1sgwA|2e-32|19.8|192/200|c.37.1.12| HM:SCP:REP 5->224|1ii8.1|1.3e-55|37.9|214/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 40855 OP:NHOMOORG 1172 OP:PATTERN KKFAGFEALKKIKJPGfIJKFKFQhINUdPRNF8BCC9FDHBAQVJRbJM*nd8MOLNOLJJF9M18A RYaJ*ZVZllnOVKTSRNM-McAAW*NNNNNMrhhjl***SqU*jxmcqaVLywtJQZ99immh*mt***VYUUUtWWXOlXW9799CNMNH4JCFF--CBNFJFTFSHM8988889BBCCCCCIRMJNULHQOUMXfeuyHGEySjadibbaWZPRKCHDHDXYVc**xVEHEEEEEJDFFCURWJGdbASaq********u********zzvz***bhp**ejrstopp**VghgkgdfedhhgecTcYZYueYZ**WOYScsrMN*zYSMUgheddhegegaliklkjjkghknikkVUUUTVVVVWVUUpWYWVVYXZab*o*********b*ek***UZZW*hhhhtdfLG**lgTXegOVZTbZNWWVIYRPPIILKIJaS***SMc*zr*t***********-bh*ba*bz**N9**************FGK**********NMNNNNNNcZcHPTTz55456555333455785578565556575HBBFCB***v*******lnkmi****vpsrXz***rs*r7Iqqjrbicf*p****TedHQINdNEFGFIGHQNJRccWl*NaSkcQZnaZgFWWUPOSbPXKPPQjqVqIFEMDHJJLIF7B8889988CQBCFJIllrPuQXKRLtMRSUSLRXNNNQOPVPQUX6-AFMHJ111222*v**W*vrzzys*y*qr-yrptwuwstuz*uopqooq*****gfejlghikjkkjiijihh*mignnnoO2************33HFDFDDDKLLLJGxj*aZZXVWIOSNLUOSdMNONNCODKOfWsttsv***kz*quZ***EDDBCFECDIbheujlkkluzwusONLJIKJFGFBBAB54ISNNEEDF98796998qBT989C9-C8E7DCAMLI8EF9DB888RZbPKWvXWYEVM -133fYC-OD39IPNGCA77CDDG7HDBB7958DCC7AAABAA687BABECEMCCCD78AAA56B47217639BB271566B99CF21-CA9C89B678565COKH4QRUbKMHVKIE9857MFiZ3a5u*c2bKdECB3U6EOP5G785P96yCJIIiDZ*CfJS6vPO*SSLGACA7*B9A9JmXb*9qaGCkWgeF ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 228-231| PSIPRED cEEEEEEEEEEEccccEEEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccHHHHHHccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHccEEEEEEccEEEEcccc //